Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GPR107 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q5VW38
Molecular weight:
25.88 kDa

Original price was: $376.00.Current price is: $327.00.

100ug 13% OFF + 327 loyalty points
Arg40–Asn250
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GPR107 Protein, N-His

Product name ARO-P10741-100
Uniprot ID Q5VW38
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVHHLALKDDVRHKVHLNTFGFFKDGYMVVNVSSLSLNEPEDKDVTIGFSLDRTKNDGFSSYLDEDVNYCILKKQSVSVTLLILDISRSEVRVKSPPEAGTQLPKIIFSRDEKVLGQSQEPNVNPASAGNQTQKTQDGGKSKRSTVDSKAMGEKSFSVHNNGGAVSFQFFFNISTDDQEGLYSLYFHKCLGKELPSDKFTFSLDIEITEKN
Molecular weight 25.88 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg40-Asn250
Aliases /Synonyms LUSTR1, Lung seven transmembrane receptor 1, GPR107, KIAA1624, Protein GPR107
Reference ARO-P10741
Note For research use only.
Molecular Constructor
Arg40–Asn250
Product name ARO-P10741-1MG
Uniprot ID Q5VW38
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVHHLALKDDVRHKVHLNTFGFFKDGYMVVNVSSLSLNEPEDKDVTIGFSLDRTKNDGFSSYLDEDVNYCILKKQSVSVTLLILDISRSEVRVKSPPEAGTQLPKIIFSRDEKVLGQSQEPNVNPASAGNQTQKTQDGGKSKRSTVDSKAMGEKSFSVHNNGGAVSFQFFFNISTDDQEGLYSLYFHKCLGKELPSDKFTFSLDIEITEKN
Molecular weight 25.88 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg40-Asn250
Aliases /Synonyms LUSTR1, Lung seven transmembrane receptor 1, GPR107, KIAA1624, Protein GPR107
Reference ARO-P10741
Note For research use only.
Molecular Constructor
Arg40–Asn250
Product name ARO-P10741-50
Uniprot ID Q5VW38
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVHHLALKDDVRHKVHLNTFGFFKDGYMVVNVSSLSLNEPEDKDVTIGFSLDRTKNDGFSSYLDEDVNYCILKKQSVSVTLLILDISRSEVRVKSPPEAGTQLPKIIFSRDEKVLGQSQEPNVNPASAGNQTQKTQDGGKSKRSTVDSKAMGEKSFSVHNNGGAVSFQFFFNISTDDQEGLYSLYFHKCLGKELPSDKFTFSLDIEITEKN
Molecular weight 25.88 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg40-Asn250
Aliases /Synonyms LUSTR1, Lung seven transmembrane receptor 1, GPR107, KIAA1624, Protein GPR107
Reference ARO-P10741
Note For research use only.
Molecular Constructor
Arg40–Asn250

Introduction to Recombinant Human GPR107 Protein

Recombinant Human GPR107 Protein, also known as G Protein-Coupled Receptor 107, is a type of protein that plays a crucial role in various biological processes. This protein is encoded by the GPR107 gene and is found in humans and other mammals. It is a transmembrane protein that belongs to the G protein-coupled receptor (GPCR) family, which is one of the largest protein families in the human genome.

Structure of Recombinant Human GPR107 Protein

The structure of Recombinant Human GPR107 Protein is composed of seven transmembrane domains, an extracellular N-terminus, and an intracellular C-terminus. The transmembrane domains are responsible for the protein’s interaction with its ligands, while the N-terminus and C-terminus play a role in signal transduction. The protein also contains several conserved motifs, including the DRY motif, which is essential for GPCR activation.

Activity of Recombinant Human GPR107 Protein

Recombinant Human GPR107 Protein is a GPCR that is activated by various ligands, including small molecules, peptides, and proteins. Upon binding to its ligands, the protein undergoes a conformational change that leads to the activation of downstream signaling pathways. These pathways include the G protein-mediated pathway, which involves the activation of G proteins, and the β-arrestin-mediated pathway, which involves the recruitment of β-arrestins.

The activation of Recombinant Human GPR107 Protein has been linked to various cellular processes, including cell proliferation, migration, and differentiation. It has also been shown to play a role in the regulation of neurotransmitter release, hormone secretion, and immune response. Additionally, this protein has been implicated in the development and progression of diseases such as cancer, diabetes, and neurological disorders.

Application of Recombinant Human GPR107 Protein

Recombinant Human GPR107 Protein has numerous applications in both research and therapeutic settings. In research, this protein is used to study the mechanisms of GPCR activation and signaling. It is also used to investigate the role of GPCRs in various physiological and pathological processes. Recombinant Human GPR107 Protein can be produced in large quantities using recombinant DNA technology, making it a valuable tool for researchers.

In therapeutic applications, Recombinant Human GPR107 Protein has the potential to be used as a drug target for various diseases. As this protein is involved in the regulation of multiple cellular processes, targeting it could lead to the development of novel treatments for various disorders. Additionally, Recombinant Human GPR107 Protein can be used in drug discovery and screening assays to identify potential drugs that can modulate its activity.

Conclusion

In summary, Recombinant Human GPR107 Protein is a transmembrane protein that belongs to the GPCR family. It plays a crucial role in various biological processes and has been linked to the development and progression of diseases. Its structure, activity, and potential applications make it a valuable protein for both research and therapeutic purposes. Further studies on this protein could lead to a better understanding of its role in health and disease and potentially pave the way for the development of new treatments.

Recombinant Human GPR107 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GPR107 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products