Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human JADE1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q6IE81
Molecular weight:
18.48 kDa

Original price was: $271.00.Current price is: $230.00.

50ug 15% OFF + 230 loyalty points
Gly217–Ser363
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human JADE1 Protein, N-His

Product name ARO-P10742-100
Uniprot ID Q6IE81
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GNEMVFCDKCNICVHQACYGILKVPEGSWLCRTCALGVQPKCLLCPKKGGAMKPTRSGTKWVHVSCALWIPEVSIGSPEKMEPITKVSHIPSSRWALVCSLCNEKFGASIQCSVKNCRTAFHVTCAFDRGLEMKTILAENDEVKFKS
Molecular weight 18.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly217-Ser363
Aliases /Synonyms KIAA1807, Jade family PHD finger protein 1, JADE1, PHD finger protein 17, Protein Jade-1, PHF17
Reference ARO-P10742
Note For research use only.
Molecular Constructor
Gly217–Ser363
Product name ARO-P10742-1MG
Uniprot ID Q6IE81
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GNEMVFCDKCNICVHQACYGILKVPEGSWLCRTCALGVQPKCLLCPKKGGAMKPTRSGTKWVHVSCALWIPEVSIGSPEKMEPITKVSHIPSSRWALVCSLCNEKFGASIQCSVKNCRTAFHVTCAFDRGLEMKTILAENDEVKFKS
Molecular weight 18.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly217-Ser363
Aliases /Synonyms KIAA1807, Jade family PHD finger protein 1, JADE1, PHD finger protein 17, Protein Jade-1, PHF17
Reference ARO-P10742
Note For research use only.
Molecular Constructor
Gly217–Ser363
Product name ARO-P10742-50
Uniprot ID Q6IE81
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GNEMVFCDKCNICVHQACYGILKVPEGSWLCRTCALGVQPKCLLCPKKGGAMKPTRSGTKWVHVSCALWIPEVSIGSPEKMEPITKVSHIPSSRWALVCSLCNEKFGASIQCSVKNCRTAFHVTCAFDRGLEMKTILAENDEVKFKS
Molecular weight 18.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly217-Ser363
Aliases /Synonyms KIAA1807, Jade family PHD finger protein 1, JADE1, PHD finger protein 17, Protein Jade-1, PHF17
Reference ARO-P10742
Note For research use only.
Molecular Constructor
Gly217–Ser363

The Structure of Recombinant Human JADE1 Protein

Recombinant Human JADE1 Protein is a type of protein that is produced through genetic engineering techniques. It is a member of the JADE family of proteins, which are known to play important roles in cell growth and development.

The structure of Recombinant Human JADE1 Protein is composed of 404 amino acids, with a molecular weight of approximately 45 kDa. It contains several functional domains, including a PHD finger, a bromodomain, and a JADE domain. These domains are responsible for the protein’s ability to interact with other molecules and carry out its biological functions.

The PHD finger domain of Recombinant Human JADE1 Protein is responsible for binding to specific histone modifications, which are important for regulating gene expression. The bromodomain, on the other hand, is involved in recognizing and binding to acetylated lysine residues on histone proteins. This allows the protein to interact with chromatin and regulate gene expression.

The JADE domain of Recombinant Human JADE1 Protein is essential for its interaction with other members of the JADE family, as well as with other proteins involved in chromatin remodeling. This domain also plays a role in the protein’s ability to regulate cell proliferation and differentiation.

The Activity of Recombinant Human JADE1 Protein

Recombinant Human JADE1 Protein is involved in a wide range of cellular processes, including gene expression, chromatin remodeling, and cell growth and differentiation. It is known to act as a transcriptional co-regulator, meaning it can influence the expression of genes by interacting with other proteins and modifying chromatin structure.

One of the main functions of Recombinant Human JADE1 Protein is its role in regulating the activity of transcription factors. By binding to specific histone modifications and interacting with other proteins, it can either activate or repress the transcription of target genes. This allows the protein to control important cellular processes, such as cell proliferation and differentiation.

In addition, Recombinant Human JADE1 Protein has been shown to play a role in chromatin remodeling. It can interact with other proteins involved in chromatin modification, such as histone acetyltransferases and deacetylases, to regulate the accessibility of DNA and control gene expression.

The Application of Recombinant Human JADE1 Protein

Recombinant Human JADE1 Protein has various applications in both basic research and clinical settings. Its role in regulating gene expression and chromatin remodeling makes it a valuable tool for studying cellular processes and understanding disease mechanisms.

In basic research, Recombinant Human JADE1 Protein can be used to study the function of the JADE family of proteins and their role in cell growth and development. It can also be used to investigate the mechanisms of gene expression and chromatin remodeling, as well as their dysregulation in diseases such as cancer.

In clinical settings, Recombinant Human JADE1 Protein has potential as a therapeutic target for diseases that involve abnormal gene expression or chromatin remodeling. It has been linked to various types of cancer, and targeting its activity may provide a new approach for cancer treatment.

In addition, Recombinant Human JADE1 Protein can also be used in diagnostic assays to detect the presence of specific histone modifications or to measure the activity of transcription factors. This can aid in the diagnosis and monitoring of diseases related to gene expression and chromatin remodeling.

In conclusion, Recombinant Human JADE1 Protein is a crucial component in regulating gene expression and chromatin structure. Its unique structure and diverse functions make it a valuable tool for both basic research and clinical applications, with potential for further advancements in understanding and treating diseases.

Recombinant Human JADE1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human JADE1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products