Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DOCK5 Protein, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H7D0
Molecular weight:
41.79 kDa

Original price was: $289.00.Current price is: $230.00.

50ug 20% OFF + 230 loyalty points
Arg1627–Ala1761
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DOCK5 Protein, N-GST

Product name ARO-P10386-100
Uniprot ID Q9H7D0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RELKEKVEKHYGVITLPPNLTERKQSRTGSIVLPYIMSSTLRRLSITSVTSSVVSTSSNSSDNAPSRPGSDGSILEPLLERRASSGARVEDLSLREENSENRISKFKRKDWSLSKSQVIAEKAPEPDLMSPTRKA
Molecular weight 41.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg1627-Ala1761
Aliases /Synonyms Dedicator of cytokinesis protein 5, DOCK5
Reference ARO-P10386
Note For research use only.
Molecular Constructor
Arg1627–Ala1761
Product name ARO-P10386-1MG
Uniprot ID Q9H7D0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RELKEKVEKHYGVITLPPNLTERKQSRTGSIVLPYIMSSTLRRLSITSVTSSVVSTSSNSSDNAPSRPGSDGSILEPLLERRASSGARVEDLSLREENSENRISKFKRKDWSLSKSQVIAEKAPEPDLMSPTRKA
Molecular weight 41.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg1627-Ala1761
Aliases /Synonyms Dedicator of cytokinesis protein 5, DOCK5
Reference ARO-P10386
Note For research use only.
Molecular Constructor
Arg1627–Ala1761
Product name ARO-P10386-50
Uniprot ID Q9H7D0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RELKEKVEKHYGVITLPPNLTERKQSRTGSIVLPYIMSSTLRRLSITSVTSSVVSTSSNSSDNAPSRPGSDGSILEPLLERRASSGARVEDLSLREENSENRISKFKRKDWSLSKSQVIAEKAPEPDLMSPTRKA
Molecular weight 41.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg1627-Ala1761
Aliases /Synonyms Dedicator of cytokinesis protein 5, DOCK5
Reference ARO-P10386
Note For research use only.
Molecular Constructor
Arg1627–Ala1761

Introduction

Recombinant Human DOCK5 Protein is a type of protein that is produced through genetic engineering techniques. It is a member of the DOCK family of proteins, which are known for their role in regulating cell signaling and cytoskeletal organization. This protein is involved in various cellular processes, including cell migration, adhesion, and proliferation. In this article, we will discuss the structure, activity, and application of Recombinant Human DOCK5 Protein.

Structure of Recombinant Human DOCK5 Protein

Recombinant Human DOCK5 Protein is a large protein consisting of 2,227 amino acids. It contains several functional domains, including a DHR-2 domain, a DHR-1 domain, and a SH3 domain. The DHR-2 domain is responsible for binding to phospholipids and activating the protein, while the DHR-1 domain is involved in binding to small GTPases. The SH3 domain is responsible for protein-protein interactions. Additionally, Recombinant Human DOCK5 Protein has a conserved C-terminal region that is important for its activity.

Activity of Recombinant Human DOCK5 Protein

Recombinant Human DOCK5 Protein is a guanine nucleotide exchange factor (GEF) for the Rho family of small GTPases. This means that it can activate these GTPases by promoting the exchange of GDP for GTP, which is necessary for their function. Specifically, Recombinant Human DOCK5 Protein is known to activate Rac1, Cdc42, and RhoG, which are involved in regulating the actin cytoskeleton and cell migration. It does this by binding to these GTPases through its DHR-1 domain and promoting their activation through its DHR-2 domain.

In addition to its role as a GEF, Recombinant Human DOCK5 Protein also plays a role in regulating cell adhesion and proliferation. It has been shown to interact with several proteins involved in these processes, including integrins and focal adhesion kinase (FAK). This suggests that Recombinant Human DOCK5 Protein may be involved in coordinating signaling pathways that control cell adhesion and proliferation.

Application of Recombinant Human DOCK5 Protein

Recombinant Human DOCK5 Protein has a wide range of applications in both research and therapeutic settings. In research, it can be used to study the role of DOCK5 in cellular processes such as cell migration, adhesion, and proliferation. It can also be used to investigate the signaling pathways regulated by this protein and its interactions with other proteins.

In terms of therapeutics, Recombinant Human DOCK5 Protein has potential as a drug target for diseases involving abnormal cell migration, such as cancer and autoimmune disorders. By targeting the activity of DOCK5, it may be possible to regulate cell migration and prevent the spread of cancer cells or the attack of immune cells on healthy tissues.

Furthermore, Recombinant Human DOCK5 Protein can also be used in the development of diagnostic tools for diseases associated with abnormal DOCK5 activity. For example, it can be used to detect the presence of DOCK5 autoantibodies in patients with autoimmune disorders.

Conclusion

Recombinant Human DOCK5 Protein is a large protein with multiple functional domains that plays a crucial role in regulating cell signaling and cytoskeletal organization. Its activity as a GEF for the Rho family of small GTPases makes it an important player in processes such as cell migration, adhesion, and proliferation. Its potential as a drug target and diagnostic tool makes it an exciting area of research for understanding and treating diseases associated with abnormal DOCK5 activity.

Recombinant Human DOCK5 Protein, N-GST

There are no reviews yet.

Be the first to review “Recombinant Human DOCK5 Protein, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products