Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CLN3 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q13286
Molecular weight:
36.06 kDa

Original price was: $262.00.Current price is: $230.00.

50ug 12% OFF + 230 loyalty points
Gln204–Val277
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CLN3 Protein, N-GST & C-His

Product name ARO-P11513-100
Uniprot ID Q13286
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLTQAGLSPQQTLLSMLGIPALLLASYFLLLTSPEAQDPGGEEEAESAARQPLIRTEAPESKPGSSSSLSLRERWT
Molecular weight 36.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln204-Val277
Aliases /Synonyms BTS, Battenin, Batten disease protein, Protein CLN3, CLN3
Reference ARO-P11513
Note For research use only.
Molecular Constructor
Gln204–Val277
Product name ARO-P11513-1MG
Uniprot ID Q13286
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLTQAGLSPQQTLLSMLGIPALLLASYFLLLTSPEAQDPGGEEEAESAARQPLIRTEAPESKPGSSSSLSLRERWT
Molecular weight 36.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln204-Val277
Aliases /Synonyms BTS, Battenin, Batten disease protein, Protein CLN3, CLN3
Reference ARO-P11513
Note For research use only.
Molecular Constructor
Gln204–Val277
Product name ARO-P11513-50
Uniprot ID Q13286
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLTQAGLSPQQTLLSMLGIPALLLASYFLLLTSPEAQDPGGEEEAESAARQPLIRTEAPESKPGSSSSLSLRERWT
Molecular weight 36.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln204-Val277
Aliases /Synonyms BTS, Battenin, Batten disease protein, Protein CLN3, CLN3
Reference ARO-P11513
Note For research use only.
Molecular Constructor
Gln204–Val277

Introduction

Recombinant human CLN3 protein, also known as ceroid-lipofuscinosis, neuronal 3 protein, is a crucial protein involved in lysosomal function. It is encoded by the CLN3 gene and is expressed in various tissues, including the brain, heart, and skeletal muscle. In this article, we will explore the structure, activity, and application of recombinant human CLN3 protein.

Structure of Recombinant Human CLN3 Protein

The recombinant human CLN3 protein is a transmembrane protein consisting of 438 amino acids. It has a molecular weight of approximately 48 kDa and is composed of six transmembrane domains, a cytoplasmic N-terminus, and a luminal C-terminus. The protein also contains two conserved motifs, the lysosomal targeting motif and the di-leucine motif, which are essential for its function.

Activity of Recombinant Human CLN3 Protein

The primary function of recombinant human CLN3 protein is to regulate lysosomal function. It is involved in the transport of lysosomal enzymes and the maintenance of lysosomal pH. The protein also plays a crucial role in the clearance of cellular debris and waste products, preventing the accumulation of lipofuscin, a hallmark of ceroid-lipofuscinosis diseases.

Moreover, recombinant human CLN3 protein has been shown to interact with other proteins, such as the lysosomal membrane protein LAMP1 and the endoplasmic reticulum protein VAPB. These interactions contribute to the proper functioning of lysosomes and the maintenance of cellular homeostasis.

Application of Recombinant Human CLN3 Protein

The recombinant human CLN3 protein has various applications in both research and clinical settings. One of its main uses is in the study of ceroid-lipofuscinosis diseases, such as juvenile Batten disease, which is caused by mutations in the CLN3 gene. Recombinant human CLN3 protein can be used to study the effects of these mutations and potentially develop therapeutic strategies.

Furthermore, recombinant human CLN3 protein has been used in drug screening assays to identify potential treatments for lysosomal storage disorders. It has also been utilized in the development of gene therapy approaches for ceroid-lipofuscinosis diseases.

Additionally, recombinant human CLN3 protein has been used as an antigen in antibody production for diagnostic and research purposes. Antibodies against CLN3 can be used to detect the protein in tissues and cells, aiding in the study of its expression and localization.

Conclusion

In summary, recombinant human CLN3 protein is a vital protein involved in lysosomal function and maintenance of cellular homeostasis. Its structure, activity, and application have been extensively studied and continue to be a focus of research in the field of lysosomal storage disorders. With further research and development, recombinant human CLN3 protein may hold the key to potential treatments for ceroid-lipofuscinosis diseases.

Recombinant Human CLN3 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human CLN3 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products