Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human CTAG1A/NY-ESO-1/LAGE-2, N-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P78358
Molecular weight:
17.99 kDa

Original price was: $345.00.Current price is: $274.00.

50ug 21% OFF + 274 loyalty points
SUMO Met1–Arg180
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human CTAG1A/NY-ESO-1/LAGE-2, N-SUMO

Recombinant Human CTAG1A/NY-ESO-1/LAGE-2, N-SUMO

Product name ARO-P13557-100
Uniprot ID P78358
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Molecular weight 17.99 kDa
Protein delivered with Tag? N-Terminal SUMO Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg180
Aliases /Synonyms LAGE2B, CTAG1, Autoimmunogenic cancer/testis antigen NY-ESO-1, Cancer/testis antigen 6.1, CTAG1A, L antigen family member 2, Cancer/testis antigen 1, LAGE2A, ESO1, CTAG, LAGE-2, LAGE2, CT6.1
Reference ARO-P13557
Note For research use only.
Molecular Constructor
SUMO Met1–Arg180
Product name ARO-P13557-1MG
Uniprot ID P78358
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Molecular weight 17.99 kDa
Protein delivered with Tag? N-Terminal SUMO Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg180
Aliases /Synonyms LAGE2B, CTAG1, Autoimmunogenic cancer/testis antigen NY-ESO-1, Cancer/testis antigen 6.1, CTAG1A, L antigen family member 2, Cancer/testis antigen 1, LAGE2A, ESO1, CTAG, LAGE-2, LAGE2, CT6.1
Reference ARO-P13557
Note For research use only.
Molecular Constructor
SUMO Met1–Arg180
Product name ARO-P13557-50
Uniprot ID P78358
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Molecular weight 17.99 kDa
Protein delivered with Tag? N-Terminal SUMO Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg180
Aliases /Synonyms LAGE2B, CTAG1, Autoimmunogenic cancer/testis antigen NY-ESO-1, Cancer/testis antigen 6.1, CTAG1A, L antigen family member 2, Cancer/testis antigen 1, LAGE2A, ESO1, CTAG, LAGE-2, LAGE2, CT6.1
Reference ARO-P13557
Note For research use only.
Molecular Constructor
SUMO Met1–Arg180

Recombinant Human CTAG1A/NY-ESO-1/LAGE-2, N-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CTAG1A/NY-ESO-1/LAGE-2, N-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products