Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Dog CD47/MER6 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Dog
Uniprot ID:
XP_038300507.1
Molecular weight:
16.22 kDa

Original price was: $350.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
Gln19–Asn140
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Dog CD47/MER6 Protein, N-His

Product name ARO-P10233-100
Uniprot ID XP_038300507.1
Origin species Dog
Expression system Prokaryotic expression
Raw Antigen Sequence GSAQLIFNITKSVEYTACNESVIIPCFVNNVEATNINEMYVKWKFRGKDIFTFDGAVQKTTHGDKFKSTKIVPQKLLNGIASLEMSKEEAVVGNYTCEVTELSREGETIIELKYRIVSWFSPNE
Molecular weight 16.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln19-Asn140
Aliases /Synonyms leukocyte surface antigen CD47 isoform X1, CD47
Reference ARO-P10233
Note For research use only.
Molecular Constructor
Gln19–Asn140
Product name ARO-P10233-1MG
Uniprot ID XP_038300507.1
Origin species Dog
Expression system Prokaryotic expression
Raw Antigen Sequence GSAQLIFNITKSVEYTACNESVIIPCFVNNVEATNINEMYVKWKFRGKDIFTFDGAVQKTTHGDKFKSTKIVPQKLLNGIASLEMSKEEAVVGNYTCEVTELSREGETIIELKYRIVSWFSPNE
Molecular weight 16.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln19-Asn140
Aliases /Synonyms leukocyte surface antigen CD47 isoform X1, CD47
Reference ARO-P10233
Note For research use only.
Molecular Constructor
Gln19–Asn140
Product name ARO-P10233-50
Uniprot ID XP_038300507.1
Origin species Dog
Expression system Prokaryotic expression
Raw Antigen Sequence GSAQLIFNITKSVEYTACNESVIIPCFVNNVEATNINEMYVKWKFRGKDIFTFDGAVQKTTHGDKFKSTKIVPQKLLNGIASLEMSKEEAVVGNYTCEVTELSREGETIIELKYRIVSWFSPNE
Molecular weight 16.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln19-Asn140
Aliases /Synonyms leukocyte surface antigen CD47 isoform X1, CD47
Reference ARO-P10233
Note For research use only.
Molecular Constructor
Gln19–Asn140

SDS-PAGE for Recombinant Dog CD47/MER6 Protein, N-His

SDS-PAGE for Recombinant Dog CD47/MER6 Protein, N-His

Recombinant Dog CD47/MER6 Protein, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Recombinant Dog CD47/MER6 Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products