Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant HAdV-2 E1B-19K Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2)
Uniprot ID:
P03247
Molecular weight:
36.67 kDa

Original price was: $301.00.Current price is: $271.00.

50ug 10% OFF + 271 loyalty points
GST Ser35–His108 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant HAdV-2 E1B-19K Protein, N-GST & C-His

Product name ARO-P16501-100
Uniprot ID P03247
Origin species Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2)
Expression system Prokaryotic expression
Raw Antigen Sequence SQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETH
Molecular weight 36.67 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser35-His108
Aliases /Synonyms E1B protein, small T-antigen, E1B 19 kDa protein, E1B-19K, E1B-175R, E1B
Reference ARO-P16501
Note For research use only.
Molecular Constructor
GST Ser35–His108 His
Product name ARO-P16501-1MG
Uniprot ID P03247
Origin species Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2)
Expression system Prokaryotic expression
Raw Antigen Sequence SQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETH
Molecular weight 36.67 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser35-His108
Aliases /Synonyms E1B protein, small T-antigen, E1B 19 kDa protein, E1B-19K, E1B-175R, E1B
Reference ARO-P16501
Note For research use only.
Molecular Constructor
GST Ser35–His108 His
Product name ARO-P16501-50
Uniprot ID P03247
Origin species Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2)
Expression system Prokaryotic expression
Raw Antigen Sequence SQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETH
Molecular weight 36.67 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser35-His108
Aliases /Synonyms E1B protein, small T-antigen, E1B 19 kDa protein, E1B-19K, E1B-175R, E1B
Reference ARO-P16501
Note For research use only.
Molecular Constructor
GST Ser35–His108 His

There are no reviews yet.

Be the first to review “Recombinant HAdV-2 E1B-19K Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products