Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant HAdV-7 Shutoff protein/L4 Protein, C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human adenovirus B serotype 7 (HAdV-7) (Human adenovirus 7)
Uniprot ID:
Q5EY60
Molecular weight:
20.67 kDa

Original price was: $296.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Leu373–Arg537 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant HAdV-7 Shutoff protein/L4 Protein, C-His

Recombinant HAdV-7 Shutoff protein/L4 Protein, C-His

Product name ARO-P16508-100
Uniprot ID Q5EY60
Origin species Human adenovirus B serotype 7 (HAdV-7) (Human adenovirus 7)
Expression system Prokaryotic expression
Raw Antigen Sequence LECLRRFFTDPETLRKLEENLHYTFRHGFVRQACKISNVELTNLVSYMGILHENRLGQSVLHTTLKGEARRDYIRDCVYLYLCHTWQTGMGVWQQCLEEQNLKELDKLLQRSLKALWTGFDERTVASDLADIIFPERLRVTLRNGLPDFMSQSMLNNFRSFILER
Molecular weight 20.67 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu373-Arg537
Aliases /Synonyms Shutoff protein, 100 kDa protein, p100K, 100K-chaperone protein, L4-100K, Shutoff protein 100K, L4
Reference ARO-P16508
Note For research use only.
Molecular Constructor
Leu373–Arg537 His
Product name ARO-P16508-1MG
Uniprot ID Q5EY60
Origin species Human adenovirus B serotype 7 (HAdV-7) (Human adenovirus 7)
Expression system Prokaryotic expression
Raw Antigen Sequence LECLRRFFTDPETLRKLEENLHYTFRHGFVRQACKISNVELTNLVSYMGILHENRLGQSVLHTTLKGEARRDYIRDCVYLYLCHTWQTGMGVWQQCLEEQNLKELDKLLQRSLKALWTGFDERTVASDLADIIFPERLRVTLRNGLPDFMSQSMLNNFRSFILER
Molecular weight 20.67 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu373-Arg537
Aliases /Synonyms Shutoff protein, 100 kDa protein, p100K, 100K-chaperone protein, L4-100K, Shutoff protein 100K, L4
Reference ARO-P16508
Note For research use only.
Molecular Constructor
Leu373–Arg537 His
Product name ARO-P16508-50
Uniprot ID Q5EY60
Origin species Human adenovirus B serotype 7 (HAdV-7) (Human adenovirus 7)
Expression system Prokaryotic expression
Raw Antigen Sequence LECLRRFFTDPETLRKLEENLHYTFRHGFVRQACKISNVELTNLVSYMGILHENRLGQSVLHTTLKGEARRDYIRDCVYLYLCHTWQTGMGVWQQCLEEQNLKELDKLLQRSLKALWTGFDERTVASDLADIIFPERLRVTLRNGLPDFMSQSMLNNFRSFILER
Molecular weight 20.67 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu373-Arg537
Aliases /Synonyms Shutoff protein, 100 kDa protein, p100K, 100K-chaperone protein, L4-100K, Shutoff protein 100K, L4
Reference ARO-P16508
Note For research use only.
Molecular Constructor
Leu373–Arg537 His

There are no reviews yet.

Be the first to review “Recombinant HAdV-7 Shutoff protein/L4 Protein, C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products