Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human AFF4 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UHB7
Molecular weight:
29.78 kDa

Original price was: $280.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Ser914–Lys1160
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human AFF4 Protein, N-His

Product name ARO-P11596-100
Uniprot ID Q9UHB7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SADHYLQEAKKLKHNADALSDRFEKAVYYLDAVVSFIECGNALEKNAQESKSPFPMYSETVDLIKYTMKLKNYLAPDATAADKRLTVLCLRCESLLYLRLFKLKKENALKYSKTLTEHLKNSYNNSQAPSPGLGSKAVGMPSPVSPKLSPGNSGNYSSGASSASASGSSVTIPQKIHQMAASYVQVTSNFLYATEIWDQAEQLSKEQKEFFAELDKVMGPLIFNASIMTDLVRYTRQGLHWLRQDAK
Molecular weight 29.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser914-Lys1160
Aliases /Synonyms Major CDK9 elongation factor-associated protein, MCEF, Protein AF-5q31, ALL1-fused gene from chromosome 5q31 protein, AF5Q31, AFF4, AF4/FMR2 family member 4
Reference ARO-P11596
Note For research use only.
Molecular Constructor
Ser914–Lys1160
Product name ARO-P11596-1MG
Uniprot ID Q9UHB7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SADHYLQEAKKLKHNADALSDRFEKAVYYLDAVVSFIECGNALEKNAQESKSPFPMYSETVDLIKYTMKLKNYLAPDATAADKRLTVLCLRCESLLYLRLFKLKKENALKYSKTLTEHLKNSYNNSQAPSPGLGSKAVGMPSPVSPKLSPGNSGNYSSGASSASASGSSVTIPQKIHQMAASYVQVTSNFLYATEIWDQAEQLSKEQKEFFAELDKVMGPLIFNASIMTDLVRYTRQGLHWLRQDAK
Molecular weight 29.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser914-Lys1160
Aliases /Synonyms Major CDK9 elongation factor-associated protein, MCEF, Protein AF-5q31, ALL1-fused gene from chromosome 5q31 protein, AF5Q31, AFF4, AF4/FMR2 family member 4
Reference ARO-P11596
Note For research use only.
Molecular Constructor
Ser914–Lys1160
Product name ARO-P11596-50
Uniprot ID Q9UHB7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SADHYLQEAKKLKHNADALSDRFEKAVYYLDAVVSFIECGNALEKNAQESKSPFPMYSETVDLIKYTMKLKNYLAPDATAADKRLTVLCLRCESLLYLRLFKLKKENALKYSKTLTEHLKNSYNNSQAPSPGLGSKAVGMPSPVSPKLSPGNSGNYSSGASSASASGSSVTIPQKIHQMAASYVQVTSNFLYATEIWDQAEQLSKEQKEFFAELDKVMGPLIFNASIMTDLVRYTRQGLHWLRQDAK
Molecular weight 29.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser914-Lys1160
Aliases /Synonyms Major CDK9 elongation factor-associated protein, MCEF, Protein AF-5q31, ALL1-fused gene from chromosome 5q31 protein, AF5Q31, AFF4, AF4/FMR2 family member 4
Reference ARO-P11596
Note For research use only.
Molecular Constructor
Ser914–Lys1160

Introduction

Recombinant Human AFF4 Protein, also known as AF4/FMR2 family member 4, is a highly conserved protein that plays a crucial role in transcriptional regulation and chromatin remodeling. This protein has been extensively studied due to its involvement in various cellular processes, including development, differentiation, and disease. In this article, we will explore the structure, activity, and application of Recombinant Human AFF4 Protein.

Structure of Recombinant Human AFF4 Protein

Recombinant Human AFF4 Protein is a 170 kDa protein that is encoded by the AFF4 gene located on chromosome 5. It is composed of 1471 amino acids and contains several functional domains, including an AF4/FMR2 family domain, a LisH domain, a PHD finger, and a proline-rich region. The AF4/FMR2 family domain is responsible for protein-protein interactions, while the LisH domain is involved in protein dimerization. The PHD finger is a zinc-binding domain that is important for chromatin binding and transcriptional regulation. The proline-rich region is thought to be involved in protein-protein interactions and may play a role in the recruitment of transcriptional regulators.

Activity of Recombinant Human AFF4 Protein

Recombinant Human AFF4 Protein is a key component of the super elongation complex (SEC), which regulates transcriptional elongation by RNA polymerase II. It interacts with other SEC components, including ELL2, EAF1, and EAF2, to promote the efficient transcription of target genes. In addition, Recombinant Human AFF4 Protein has been shown to interact with the histone acetyltransferase p300, suggesting a potential role in chromatin remodeling.

Studies have also demonstrated that Recombinant Human AFF4 Protein is essential for the development and maintenance of embryonic stem cells. It has been shown to regulate the expression of pluripotency genes and is required for the self-renewal and differentiation of these cells. In addition, Recombinant Human AFF4 Protein has been implicated in the development of various tissues, including the brain, heart, and immune system.

Application of Recombinant Human AFF4 Protein

Due to its important role in transcriptional regulation and development, Recombinant Human AFF4 Protein has been studied for its potential applications in various fields. One of the main applications of this protein is in cancer research. It has been found to be overexpressed in several types of cancer, including leukemia, breast cancer, and colon cancer. Inhibition of Recombinant Human AFF4 Protein has been shown to reduce tumor growth and sensitize cancer cells to chemotherapy, making it a potential target for cancer therapy.

Recombinant Human AFF4 Protein has also been studied for its potential use in regenerative medicine. As mentioned earlier, it plays a crucial role in the development and maintenance of embryonic stem cells, making it a potential candidate for cell-based therapies. Furthermore, its involvement in tissue development suggests that it may have a role in tissue regeneration and repair.

Another potential application of Recombinant Human AFF4 Protein is in the treatment of neurodegenerative diseases. Studies have shown that it is involved in the regulation of neuronal development and synaptic plasticity, making it a potential target for the treatment of disorders such as Alzheimer’s and Parkinson’s disease.

Conclusion

In summary, Recombinant Human AFF4 Protein is a highly conserved protein with important roles in transcriptional regulation, development, and disease. Its structure and activity have been extensively studied, and it has shown potential applications in cancer research, regenerative medicine, and neurodegenerative diseases. Further research on this protein may lead to a better understanding of its functions and potential therapeutic uses.

Recombinant Human AFF4 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human AFF4 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products