Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human AP1M1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BXS5
Molecular weight:
31.81 kDa

Original price was: $326.00.Current price is: $274.00.

50ug 16% OFF + 274 loyalty points
Met1–Pro258
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human AP1M1, N-His

Product name ARO-P12794-100
Uniprot ID Q9BXS5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPP
Molecular weight 31.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro258
Aliases /Synonyms Clathrin coat-associated protein AP47, Adaptor-related protein complex 1 subunit mu-1, Mu-adaptin 1, Adaptor protein complex AP-1 subunit mu-1, Clathrin coat assembly protein AP47, Golgi adaptor HA1/AP1 adaptin mu-1 subunit, Mu1A-adaptin, AP-1 complex subunit mu-1, CLTNM, AP1M1, Clathrin assembly protein complex 1 mu-1 medium chain 1, AP-mu chain family member mu1A
Reference ARO-P12794
Note For research use only.
Molecular Constructor
Met1–Pro258
Product name ARO-P12794-1MG
Uniprot ID Q9BXS5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPP
Molecular weight 31.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro258
Aliases /Synonyms Clathrin coat-associated protein AP47, Adaptor-related protein complex 1 subunit mu-1, Mu-adaptin 1, Adaptor protein complex AP-1 subunit mu-1, Clathrin coat assembly protein AP47, Golgi adaptor HA1/AP1 adaptin mu-1 subunit, Mu1A-adaptin, AP-1 complex subunit mu-1, CLTNM, AP1M1, Clathrin assembly protein complex 1 mu-1 medium chain 1, AP-mu chain family member mu1A
Reference ARO-P12794
Note For research use only.
Molecular Constructor
Met1–Pro258
Product name ARO-P12794-50
Uniprot ID Q9BXS5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPP
Molecular weight 31.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro258
Aliases /Synonyms Clathrin coat-associated protein AP47, Adaptor-related protein complex 1 subunit mu-1, Mu-adaptin 1, Adaptor protein complex AP-1 subunit mu-1, Clathrin coat assembly protein AP47, Golgi adaptor HA1/AP1 adaptin mu-1 subunit, Mu1A-adaptin, AP-1 complex subunit mu-1, CLTNM, AP1M1, Clathrin assembly protein complex 1 mu-1 medium chain 1, AP-mu chain family member mu1A
Reference ARO-P12794
Note For research use only.
Molecular Constructor
Met1–Pro258

Introduction

Recombinant Human AP1M1 is a type of recombinant protein that plays an important role in intracellular trafficking and vesicle formation. It is a subunit of the AP1M1 protein complex, which is involved in the sorting and transport of proteins within the cell. In this article, we will discuss the structure, activity, and applications of Recombinant Human AP1M1.

Structure of Recombinant Human AP1M1

Recombinant Human AP1M1 is a protein that is composed of 357 amino acids with a molecular weight of approximately 40 kDa. It is encoded by the AP1M1 gene located on chromosome 19 in humans. The protein is made up of four domains: the N-terminal domain, the hinge region, the core domain, and the C-terminal domain.

The N-terminal domain of Recombinant Human AP1M1 is responsible for binding to the other subunits of the AP1M1 protein complex. The hinge region connects the N-terminal domain to the core domain, which is the largest domain of the protein. The core domain contains a beta-sandwich fold and is involved in protein-protein interactions. The C-terminal domain is responsible for binding to cargo molecules and is essential for the sorting and transport of proteins within the cell.

Activity of Recombinant Human AP1M1

Recombinant Human AP1M1 plays a crucial role in intracellular trafficking and vesicle formation. It is a subunit of the AP1M1 protein complex, which is involved in the formation of clathrin-coated vesicles. These vesicles are responsible for the transport of proteins from the trans-Golgi network to endosomes and lysosomes, as well as from the plasma membrane to endosomes.

The activity of Recombinant Human AP1M1 is regulated by its interaction with other subunits of the AP1M1 protein complex and cargo molecules. The N-terminal domain of the protein binds to the other subunits, while the C-terminal domain binds to cargo molecules. This interaction is critical for the proper sorting and transport of proteins within the cell.

Applications of Recombinant Human AP1M1

Recombinant Human AP1M1 has various applications in both research and medical fields. Due to its role in intracellular trafficking, it is commonly used as a marker for the identification and study of clathrin-coated vesicles. It is also used in studies related to protein sorting and transport in cells.

In the medical field, Recombinant Human AP1M1 has been studied for its potential role in various diseases. Mutations in the AP1M1 gene have been linked to a rare genetic disorder called Hermansky-Pudlak syndrome, which affects the pigmentation of the skin, hair, and eyes, as well as the function of various organs. Recombinant Human AP1M1 has also been studied for its potential role in cancer, as abnormal intracellular trafficking has been observed in cancer cells.

Furthermore, Recombinant Human AP1M1 has potential therapeutic applications. It has been studied for its ability to inhibit the growth of cancer cells by disrupting their intracellular trafficking pathways. It has also been investigated for its potential role in the treatment of lysosomal storage disorders, as it is involved in the transport of lysosomal enzymes.

Conclusion

In conclusion, Recombinant Human AP1M1 is a crucial protein involved in intracellular trafficking and vesicle formation. Its structure, activity, and applications have been extensively studied, and it has been found to play a vital role in various cellular processes. Further research on this protein may lead to a better understanding of its functions and potential therapeutic applications in the future.

Recombinant Human AP1M1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human AP1M1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products