Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human APMAP, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9HDC9
Molecular weight:
27.79 kDa

Original price was: $363.00.Current price is: $327.00.

100ug 10% OFF + 327 loyalty points
Glu62–Leu289
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human APMAP, N-His

Product name ARO-P13085-100
Uniprot ID Q9HDC9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ESPIDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGL
Molecular weight 27.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu62-Leu289
Aliases /Synonyms Protein BSCv, APMAP, Adipocyte plasma membrane-associated protein, C20orf3
Reference ARO-P13085
Note For research use only.
Molecular Constructor
Glu62–Leu289
Product name ARO-P13085-1MG
Uniprot ID Q9HDC9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ESPIDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGL
Molecular weight 27.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu62-Leu289
Aliases /Synonyms Protein BSCv, APMAP, Adipocyte plasma membrane-associated protein, C20orf3
Reference ARO-P13085
Note For research use only.
Molecular Constructor
Glu62–Leu289
Product name ARO-P13085-50
Uniprot ID Q9HDC9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ESPIDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGL
Molecular weight 27.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu62-Leu289
Aliases /Synonyms Protein BSCv, APMAP, Adipocyte plasma membrane-associated protein, C20orf3
Reference ARO-P13085
Note For research use only.
Molecular Constructor
Glu62–Leu289

Recombinant Human APMAP (Adipocyte Plasma Membrane-Associated Protein) is a protein that has been produced through the process of genetic engineering, also known as recombinant DNA technology. This technology involves the insertion of a specific gene, in this case the APMAP gene, into a host organism, such as bacteria or yeast, to produce large quantities of the desired protein.

The structure of Recombinant Human APMAP is composed of 287 amino acids and has a molecular weight of approximately 33 kDa. It is a single polypeptide chain that contains two distinct domains: an N-terminal domain and a C-terminal domain. The N-terminal domain is responsible for the binding of lipids, while the C-terminal domain is involved in protein-protein interactions.

The N-terminal domain of Recombinant Human APMAP contains two alpha-helices and a beta-sheet, which form a hydrophobic pocket that is capable of binding to different types of lipids, such as phosphatidylcholine and sphingomyelin. This binding ability is essential for the role of APMAP in maintaining the structural integrity of the adipocyte plasma membrane.

The C-terminal domain of Recombinant Human APMAP is rich in charged amino acids and contains a conserved sequence motif that is found in other proteins involved in membrane trafficking. This domain is responsible for the interaction of APMAP with other proteins, such as caveolin-1, which is involved in the formation of caveolae, small invaginations of the plasma membrane that are important for various cellular processes.

Activity of Recombinant Human APMAP

The primary function of Recombinant Human APMAP is to maintain the structural integrity of the adipocyte plasma membrane. This is achieved through its ability to bind to various lipids and interact with other proteins involved in membrane trafficking. APMAP is also involved in the regulation of lipid metabolism and insulin signaling pathways.

Studies have shown that APMAP is highly expressed in adipose tissue, particularly in adipocytes, which are responsible for the storage and release of lipids. It has been suggested that APMAP may play a role in the regulation of adipocyte differentiation, as its expression is increased during the early stages of adipogenesis.

Furthermore, Recombinant Human APMAP has been shown to interact with other proteins involved in lipid metabolism, such as adipose triglyceride lipase (ATGL) and hormone-sensitive lipase (HSL). This interaction may play a role in the regulation of lipolysis, the breakdown of triglycerides into free fatty acids and glycerol, which is an important process in energy metabolism.

Application of Recombinant Human APMAP

Recombinant Human APMAP has a wide range of potential applications in both research and clinical settings. Its role in maintaining the structural integrity of the adipocyte plasma membrane makes it a valuable tool for studying the mechanisms involved in lipid metabolism and insulin signaling pathways.

In addition, APMAP has been implicated in various diseases, such as obesity and type 2 diabetes. Studies have shown that APMAP expression is increased in obese individuals and is associated with insulin resistance. Therefore, Recombinant Human APMAP can be used as a potential therapeutic target for these conditions.

Moreover, the ability of APMAP to interact with other proteins involved in lipid metabolism makes it a promising candidate for the development of new drugs for the treatment of metabolic disorders. By targeting APMAP, it may be possible to regulate lipid metabolism and improve insulin sensitivity, which could have a significant impact on the management of obesity and type 2 diabetes.

In conclusion, Recombinant Human APMAP is a unique protein that plays a crucial role in maintaining the structural integrity of the adipocyte plasma membrane and regulating lipid metabolism and insulin signaling pathways. Its diverse functions and potential applications make it a valuable tool for research and a promising target for the development of new treatments for metabolic disorders.

Recombinant Human APMAP, N-His

There are no reviews yet.

Be the first to review “Recombinant Human APMAP, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products