Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human AQP7 Protein, N-His-KSI

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
O14520
Molecular weight:
27.47 kDa

Original price was: $470.00.Current price is: $392.00.

100ug 17% OFF + 392 loyalty points
Phe236–Phe342
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Recombinant Human AQP7 Protein, N-His-KSI

Recombinant Human AQP7 Protein, N-His-KSI

Product name ARO-P10187-100
Uniprot ID O14520
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence FTFIAGWGKQVFSNGENWWWVPVVAPLLGAYLGGIIYLVFIGSTIPREPLKLEDSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMALEHF
Molecular weight 27.47 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe236-Phe342
Aliases /Synonyms Aquaporin-7, AQP-7, Aquaglyceroporin-7, Aquaporin adipose, AQPap, Aquaporin-7-like, AQP7, AQP7L, AQP9
Reference ARO-P10187
Note For research use only.
Molecular Constructor
Phe236–Phe342
Product name ARO-P10187-1MG
Uniprot ID O14520
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence FTFIAGWGKQVFSNGENWWWVPVVAPLLGAYLGGIIYLVFIGSTIPREPLKLEDSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMALEHF
Molecular weight 27.47 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe236-Phe342
Aliases /Synonyms Aquaporin-7, AQP-7, Aquaglyceroporin-7, Aquaporin adipose, AQPap, Aquaporin-7-like, AQP7, AQP7L, AQP9
Reference ARO-P10187
Note For research use only.
Molecular Constructor
Phe236–Phe342
Product name ARO-P10187-50
Uniprot ID O14520
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence FTFIAGWGKQVFSNGENWWWVPVVAPLLGAYLGGIIYLVFIGSTIPREPLKLEDSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMALEHF
Molecular weight 27.47 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe236-Phe342
Aliases /Synonyms Aquaporin-7, AQP-7, Aquaglyceroporin-7, Aquaporin adipose, AQPap, Aquaporin-7-like, AQP7, AQP7L, AQP9
Reference ARO-P10187
Note For research use only.
Molecular Constructor
Phe236–Phe342

SDS-PAGE for Recombinant Human AQP7 Protein, N-His-KSI

SDS-PAGE for Recombinant Human AQP7 Protein, N-His-KSI

Recombinant Human AQP7 Protein, N-His-KSI, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Recombinant Human AQP7 Protein, N-His-KSI”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products