Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human HOXA2 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
O43364
Molecular weight:
35.54 kDa

Original price was: $262.00.Current price is: $230.00.

50ug 12% OFF + 230 loyalty points
Thr151–Asn209
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human HOXA2 Protein, N-GST & C-His

Recombinant Human HOXA2 Protein, N-GST & C-His

Product name ARO-P10132-100
Uniprot ID O43364
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence TNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQN
Molecular weight 35.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr151-Asn209
Aliases /Synonyms Homeobox protein Hox-A2, Homeobox protein Hox-1K, HOXA2, HOX1K
Reference ARO-P10132
Note For research use only.
Molecular Constructor
Thr151–Asn209
Product name ARO-P10132-1MG
Uniprot ID O43364
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence TNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQN
Molecular weight 35.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr151-Asn209
Aliases /Synonyms Homeobox protein Hox-A2, Homeobox protein Hox-1K, HOXA2, HOX1K
Reference ARO-P10132
Note For research use only.
Molecular Constructor
Thr151–Asn209
Product name ARO-P10132-50
Uniprot ID O43364
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence TNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQN
Molecular weight 35.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr151-Asn209
Aliases /Synonyms Homeobox protein Hox-A2, Homeobox protein Hox-1K, HOXA2, HOX1K
Reference ARO-P10132
Note For research use only.
Molecular Constructor
Thr151–Asn209

There are no reviews yet.

Be the first to review “Recombinant Human HOXA2 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products