Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ARG1/Arginase-1 Protein, C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P05089
Molecular weight:
35.56 kDa

Original price was: $328.00.Current price is: $274.00.

50ug 16% OFF + 274 loyalty points
Cys45–Lys322
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ARG1/Arginase-1 Protein, C-His

Product name ARO-P10334-100
Uniprot ID P05089
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Molecular weight 35.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys45-Lys322
Aliases /Synonyms Liver-type arginase, ARG1, Type I arginase, Arginase-1
Reference ARO-P10334
Note For research use only.
Molecular Constructor
Cys45–Lys322
Product name ARO-P10334-1MG
Uniprot ID P05089
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Molecular weight 35.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys45-Lys322
Aliases /Synonyms Liver-type arginase, ARG1, Type I arginase, Arginase-1
Reference ARO-P10334
Note For research use only.
Molecular Constructor
Cys45–Lys322
Product name ARO-P10334-50
Uniprot ID P05089
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Molecular weight 35.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys45-Lys322
Aliases /Synonyms Liver-type arginase, ARG1, Type I arginase, Arginase-1
Reference ARO-P10334
Note For research use only.
Molecular Constructor
Cys45–Lys322

Introduction to Recombinant Human ARG1/Arginase-1 Protein

Recombinant Human ARG1/Arginase-1 Protein is a highly specialized protein that plays a crucial role in the metabolism of the amino acid arginine. This protein is produced through recombinant DNA technology, where the gene for human ARG1 is inserted into a suitable host organism, typically a bacterial or yeast cell, to produce large quantities of the protein.

Structure of Recombinant Human ARG1/Arginase-1 Protein

The recombinant protein is a homotrimer, meaning it is composed of three identical subunits. Each subunit is made up of 322 amino acids and has a molecular weight of approximately 36 kDa. The overall structure of the protein is similar to that of other arginases, with a central active site containing a binuclear manganese cluster that is essential for its catalytic activity.

Activity of Recombinant Human ARG1/Arginase-1 Protein

The main function of Recombinant Human ARG1/Arginase-1 Protein is to catalyze the hydrolysis of arginine into urea and ornithine. This reaction is crucial for the urea cycle, a metabolic pathway that converts toxic ammonia into urea for excretion in the urine. This process is essential for maintaining the balance of nitrogen in the body and for preventing the buildup of toxic ammonia, which can lead to serious health problems.

In addition to its role in the urea cycle, Recombinant Human ARG1/Arginase-1 Protein also plays a role in regulating the availability of arginine for other metabolic pathways. By converting arginine into ornithine, the protein indirectly affects the production of nitric oxide, a signaling molecule involved in various physiological processes such as blood vessel dilation and immune response.

Application of Recombinant Human ARG1/Arginase-1 Protein

The recombinant protein has a wide range of applications in both research and clinical settings. One of its primary uses is in studying the role of arginase in various diseases. Defects in the ARG1 gene have been linked to rare genetic disorders such as arginase deficiency and hyperargininemia, and the recombinant protein can be used to investigate the underlying mechanisms of these conditions.

Furthermore, Recombinant Human ARG1/Arginase-1 Protein has potential therapeutic applications. Studies have shown that the protein can be used to treat conditions associated with high levels of arginine, such as pulmonary hypertension and sickle cell disease. It has also been investigated as a potential treatment for cancer, as arginase has been found to play a role in suppressing the growth of certain types of tumors.

In addition, the recombinant protein is used in the production of diagnostic assays for arginase activity. These assays are crucial for detecting and monitoring arginase-related disorders, as well as measuring the activity of the protein in various biological samples.

Conclusion

In summary, Recombinant Human ARG1/Arginase-1 Protein is a crucial protein in the metabolism of arginine, with important roles in the urea cycle and other physiological processes. Its production through recombinant DNA technology has allowed for its widespread use in research and clinical applications, making it a valuable tool in understanding and treating various diseases. As further studies continue to uncover the diverse functions of this protein, its potential for therapeutic use may also expand, making it an even more significant player in the field of biotechnology.

Recombinant Human ARG1/Arginase-1 Protein, C-His

There are no reviews yet.

Be the first to review “Recombinant Human ARG1/Arginase-1 Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products