Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ARHGAP5 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q13017
Molecular weight:
29.09 kDa

Original price was: $267.00.Current price is: $230.00.

50ug 14% OFF + 230 loyalty points
Ser12–Lys248
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ARHGAP5 Protein, N-His

Product name ARO-P11621-100
Uniprot ID Q13017
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYTISIVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTIDFGGRVVNNDHFLYWGDIIQNSEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAAASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFVNNLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFNVNIETCFTALVQMLDK
Molecular weight 29.09 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser12-Lys248
Aliases /Synonyms Rho-type GTPase-activating protein 5, ARHGAP5, RHOGAP5, p190-B, Rho GTPase-activating protein 5
Reference ARO-P11621
Note For research use only.
Molecular Constructor
Ser12–Lys248
Product name ARO-P11621-1MG
Uniprot ID Q13017
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYTISIVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTIDFGGRVVNNDHFLYWGDIIQNSEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAAASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFVNNLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFNVNIETCFTALVQMLDK
Molecular weight 29.09 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser12-Lys248
Aliases /Synonyms Rho-type GTPase-activating protein 5, ARHGAP5, RHOGAP5, p190-B, Rho GTPase-activating protein 5
Reference ARO-P11621
Note For research use only.
Molecular Constructor
Ser12–Lys248
Product name ARO-P11621-50
Uniprot ID Q13017
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYTISIVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTIDFGGRVVNNDHFLYWGDIIQNSEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAAASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFVNNLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFNVNIETCFTALVQMLDK
Molecular weight 29.09 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser12-Lys248
Aliases /Synonyms Rho-type GTPase-activating protein 5, ARHGAP5, RHOGAP5, p190-B, Rho GTPase-activating protein 5
Reference ARO-P11621
Note For research use only.
Molecular Constructor
Ser12–Lys248

Introduction

Recombinant Human ARHGAP5 Protein, also known as Rho GTPase-activating protein 5, is a type of recombinant protein that has been extensively studied for its structure, activity, and potential applications. This protein plays a crucial role in regulating the activity of Rho GTPases, which are key signaling molecules involved in various cellular processes such as cell migration, proliferation, and adhesion. In this article, we will delve into the details of Recombinant Human ARHGAP5 Protein, including its structure, activity, and potential applications.

Structure of Recombinant Human ARHGAP5 Protein

Recombinant Human ARHGAP5 Protein is a 120 kDa protein that is encoded by the ARHGAP5 gene. This protein consists of 1076 amino acids and is composed of several functional domains, including a Rho GTPase-activating domain (RhoGAP), a proline-rich region, and a pleckstrin homology (PH) domain. The RhoGAP domain is responsible for the protein’s main activity, which is the stimulation of GTP hydrolysis by Rho GTPases. The proline-rich region and PH domain are involved in protein-protein interactions and membrane binding, respectively.

Activity of Recombinant Human ARHGAP5 Protein

The main activity of Recombinant Human ARHGAP5 Protein is the regulation of Rho GTPases. These small GTPases play a crucial role in various cellular processes by cycling between an active GTP-bound state and an inactive GDP-bound state. The RhoGAP domain of ARHGAP5 protein binds to the active form of Rho GTPases and stimulates their GTPase activity, leading to their inactivation. This, in turn, regulates downstream signaling pathways and affects cellular processes such as cell migration, proliferation, and adhesion.

Moreover, Recombinant Human ARHGAP5 Protein has been shown to interact with other proteins involved in cell signaling, such as focal adhesion kinase (FAK) and paxillin. These interactions further contribute to the protein’s activity and its role in regulating cell adhesion and migration.

Applications of Recombinant Human ARHGAP5 Protein

The unique structure and activity of Recombinant Human ARHGAP5 Protein make it a promising candidate for various applications in the field of cell biology and medicine. Here are some potential applications of this protein:

1. Study of Rho GTPase signaling

As mentioned earlier, Recombinant Human ARHGAP5 Protein plays a crucial role in regulating Rho GTPase activity. Therefore, it can be used as a tool in studying the signaling pathways involving these important molecules. By manipulating the expression or activity of ARHGAP5 protein, researchers can gain a better understanding of the role of Rho GTPases in various cellular processes.

2. Drug development

Dysregulation of Rho GTPase signaling has been linked to various diseases, including cancer and neurological disorders. As such, Recombinant Human ARHGAP5 Protein can be a potential target for drug development. By modulating the activity of this protein, it may be possible to regulate Rho GTPase signaling and potentially treat diseases associated with its dysfunction.

3. Biomarker for cancer

Recent studies have shown that ARHGAP5 protein is overexpressed in certain types of cancer, such as breast cancer and colorectal cancer. This makes it a potential biomarker for these diseases. By detecting the levels of ARHGAP5 protein in patient samples, it may be possible to diagnose and monitor the progression of cancer.

4. Therapeutic target for autoimmune diseases

Autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis,

Recombinant Human ARHGAP5 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ARHGAP5 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products