Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ARID3A Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99856
Molecular weight:
17.71 kDa

Original price was: $455.00.Current price is: $392.00.

100ug 14% OFF + 392 loyalty points
Gly221–Arg351
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ARID3A Protein, N-His

Product name ARO-P11257-100
Uniprot ID Q99856
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GDWTYEEQFKQLYELDGDPKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRR
Molecular weight 17.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly221-Arg351
Aliases /Synonyms Bright, DRIL3, E2F-binding protein 1, ARID domain-containing protein 3A, ARID3A, DRX, E2FBP1, DRIL1, AT-rich interactive domain-containing protein 3A, B-cell regulator of IgH transcription, Dead ringer-like protein 1
Reference ARO-P11257
Note For research use only.
Molecular Constructor
Gly221–Arg351
Product name ARO-P11257-1MG
Uniprot ID Q99856
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GDWTYEEQFKQLYELDGDPKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRR
Molecular weight 17.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly221-Arg351
Aliases /Synonyms Bright, DRIL3, E2F-binding protein 1, ARID domain-containing protein 3A, ARID3A, DRX, E2FBP1, DRIL1, AT-rich interactive domain-containing protein 3A, B-cell regulator of IgH transcription, Dead ringer-like protein 1
Reference ARO-P11257
Note For research use only.
Molecular Constructor
Gly221–Arg351
Product name ARO-P11257-50
Uniprot ID Q99856
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GDWTYEEQFKQLYELDGDPKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRR
Molecular weight 17.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly221-Arg351
Aliases /Synonyms Bright, DRIL3, E2F-binding protein 1, ARID domain-containing protein 3A, ARID3A, DRX, E2FBP1, DRIL1, AT-rich interactive domain-containing protein 3A, B-cell regulator of IgH transcription, Dead ringer-like protein 1
Reference ARO-P11257
Note For research use only.
Molecular Constructor
Gly221–Arg351

Recombinant Human ARID3A Protein: Structure, Activity, and Application

Introduction

Recombinant proteins are proteins that are produced through the use of genetic engineering techniques, allowing for the production of large quantities of specific proteins. One such protein is the Recombinant Human ARID3A Protein, also known as AT-rich interactive domain-containing protein 3A.

Structure of Recombinant Human ARID3A Protein

The Recombinant Human ARID3A Protein is a transcription factor that belongs to the ARID (AT-rich interactive domain) family of proteins. It is composed of 513 amino acids and has a molecular weight of approximately 58 kDa. The protein contains two functional domains: the ARID domain and the DNA-binding domain. The ARID domain is responsible for DNA binding, while the DNA-binding domain is responsible for the transcriptional activation of target genes.

Activity of Recombinant Human ARID3A Protein

The main activity of Recombinant Human ARID3A Protein is its role as a transcription factor. It binds to specific DNA sequences, known as ARID-binding sites, and regulates the expression of target genes. The protein has been shown to play a critical role in the development and differentiation of various cell types, including B cells, T cells, and neural cells. It is also involved in the regulation of cell cycle progression and apoptosis.

Application of Recombinant Human ARID3A Protein

The unique structure and activity of Recombinant Human ARID3A Protein make it a valuable tool in various scientific applications. Some of its potential applications include:

1. Production of Antibodies

Recombinant Human ARID3A Protein can be used as an antigen to produce specific antibodies. These antibodies can then be used in research and diagnostic applications to detect the presence of ARID3A in various tissues and cell types.

2. Gene Regulation Studies

As a transcription factor, Recombinant Human ARID3A Protein can be used to study the regulation of gene expression. By manipulating the levels of ARID3A in cells, researchers can gain insights into the role of this protein in various cellular processes.

3. Drug Discovery

Aberrant expression of ARID3A has been linked to various diseases, including cancer. Therefore, Recombinant Human ARID3A Protein can be used in drug discovery efforts to identify compounds that can modulate its activity. This can lead to the development of new treatments for diseases associated with ARID3A dysregulation.

4. Cell Differentiation Studies

Recombinant Human ARID3A Protein is known to play a crucial role in cell differentiation. Therefore, it can be used in studies to understand the mechanisms involved in the differentiation of various cell types. This can provide valuable insights into the development and function of different tissues and organs.

5. Stem Cell Research

Stem cells have the ability to differentiate into various cell types, and Recombinant Human ARID3A Protein has been shown to play a crucial role in this process. Therefore, it can be used in stem cell research to understand the mechanisms involved in cell differentiation and potentially improve the efficiency of stem cell therapies.

Conclusion

In summary, Recombinant Human ARID3A Protein is a valuable tool in scientific research, with its unique structure and activity allowing for various applications in the fields of gene regulation, drug discovery, and cell differentiation. Its role in various cellular processes makes it a promising target for future therapeutic interventions.

Recombinant Human ARID3A Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ARID3A Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products