Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human RPL23A Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P62750
Molecular weight:
22.19 kDa

Original price was: $274.00.Current price is: $230.00.

50ug 16% OFF + 230 loyalty points
Lys70–Ile156
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human RPL23A Protein, N-His-SUMO

Recombinant Human RPL23A Protein, N-His-SUMO

Product name ARO-P12149-100
Uniprot ID P62750
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVANKIGII
Molecular weight 22.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys70-Ile156
Aliases /Synonyms Large ribosomal subunit protein uL23, RPL23A, 60S ribosomal protein L23a
Reference ARO-P12149
Note For research use only.
Molecular Constructor
Lys70–Ile156
Product name ARO-P12149-1MG
Uniprot ID P62750
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVANKIGII
Molecular weight 22.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys70-Ile156
Aliases /Synonyms Large ribosomal subunit protein uL23, RPL23A, 60S ribosomal protein L23a
Reference ARO-P12149
Note For research use only.
Molecular Constructor
Lys70–Ile156
Product name ARO-P12149-50
Uniprot ID P62750
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVANKIGII
Molecular weight 22.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys70-Ile156
Aliases /Synonyms Large ribosomal subunit protein uL23, RPL23A, 60S ribosomal protein L23a
Reference ARO-P12149
Note For research use only.
Molecular Constructor
Lys70–Ile156

Recombinant Human RPL23A Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human RPL23A Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products