Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SNU13 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P55769
Molecular weight:
16.34 kDa

Original price was: $501.00.Current price is: $392.00.

100ug 22% OFF + 392 loyalty points
Met1–Val128
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SNU13 Protein, N-His

Product name ARO-P11994-100
Uniprot ID P55769
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Molecular weight 16.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Val128
Aliases /Synonyms High mobility group-like nuclear protein 2 homolog 1, SNU13, U4/U6.U5 tri-snRNP 15.5 kDa protein, OTK27, hSNU13, SNU13 homolog, U4/U6.U5 small nuclear ribonucleoprotein SNU13, NHP2-like protein 1, NHP2L1
Reference ARO-P11994
Note For research use only.
Molecular Constructor
Met1–Val128
Product name ARO-P11994-1MG
Uniprot ID P55769
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Molecular weight 16.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Val128
Aliases /Synonyms High mobility group-like nuclear protein 2 homolog 1, SNU13, U4/U6.U5 tri-snRNP 15.5 kDa protein, OTK27, hSNU13, SNU13 homolog, U4/U6.U5 small nuclear ribonucleoprotein SNU13, NHP2-like protein 1, NHP2L1
Reference ARO-P11994
Note For research use only.
Molecular Constructor
Met1–Val128
Product name ARO-P11994-50
Uniprot ID P55769
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Molecular weight 16.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Val128
Aliases /Synonyms High mobility group-like nuclear protein 2 homolog 1, SNU13, U4/U6.U5 tri-snRNP 15.5 kDa protein, OTK27, hSNU13, SNU13 homolog, U4/U6.U5 small nuclear ribonucleoprotein SNU13, NHP2-like protein 1, NHP2L1
Reference ARO-P11994
Note For research use only.
Molecular Constructor
Met1–Val128

Introduction to Recombinant Human SNU13 Protein

Recombinant Human SNU13 Protein, also known as SNU13 or small nuclear ribonucleoprotein-associated protein, is a highly conserved protein that plays an important role in various cellular processes. It is a recombinant protein, meaning it is produced through genetic engineering techniques, and is widely used in scientific research and biotechnology applications.

Structure of Recombinant Human SNU13 Protein

The structure of Recombinant Human SNU13 Protein consists of 135 amino acids with a molecular weight of approximately 15 kDa. It is composed of a single domain with a characteristic RNA recognition motif (RRM) that is responsible for binding to RNA molecules. The RRM is a common structural motif found in many RNA-binding proteins and is essential for their function.

In addition to the RRM, Recombinant Human SNU13 Protein also contains a nuclear localization signal (NLS) which allows it to be transported into the nucleus where it carries out its functions. The NLS is a short sequence of amino acids that is recognized by specific transport proteins, enabling the protein to enter the nucleus.

Activity of Recombinant Human SNU13 Protein

The main function of Recombinant Human SNU13 Protein is to participate in the assembly and maturation of small nuclear ribonucleoproteins (snRNPs). These snRNPs are essential components of the spliceosome, a large complex responsible for removing introns from pre-mRNA during the process of gene expression.

Recombinant Human SNU13 Protein interacts with other proteins, such as Sm proteins, to form the core of the snRNP particle. It also plays a role in the recognition and binding of specific RNA sequences, facilitating the formation of the snRNP complex. This activity is crucial for the proper functioning of the spliceosome and ultimately, for the accurate processing of pre-mRNA.

In addition to its role in splicing, Recombinant Human SNU13 Protein has been shown to be involved in other cellular processes such as ribosome biogenesis, mRNA export, and DNA repair. It has also been linked to diseases such as cancer and neurological disorders, highlighting its importance in maintaining cellular homeostasis.

Applications of Recombinant Human SNU13 Protein

Due to its critical role in various cellular processes, Recombinant Human SNU13 Protein has a wide range of applications in scientific research and biotechnology. One of the main uses of this protein is in the study of RNA splicing and the spliceosome complex. Its ability to interact with other proteins and RNA molecules makes it a valuable tool for understanding the mechanisms of splicing and identifying potential therapeutic targets for diseases caused by splicing defects.

Recombinant Human SNU13 Protein is also used in the production of diagnostic tests and vaccines. Its ability to bind to specific RNA sequences makes it a useful antigen in the development of diagnostic assays for infectious diseases caused by RNA viruses. It has also been used as an immunogen in the production of vaccines against viral infections.

Furthermore, Recombinant Human SNU13 Protein is used in the biotechnology industry for the production of recombinant proteins. Its small size, stability, and high expression levels make it an ideal fusion partner for the production of difficult-to-express proteins. It has also been used as a tag for the purification of recombinant proteins through affinity chromatography.

Conclusion

Recombinant Human SNU13 Protein is a versatile protein with a crucial role in various cellular processes. Its structure, activity, and applications make it a valuable tool in scientific research and biotechnology. As our understanding of its functions continues to grow, it is likely that Recombinant Human SNU13 Protein will play an even more significant role in advancing our knowledge of cellular processes and in the development of new therapies for diseases.</

Recombinant Human SNU13 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SNU13 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products