Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SNRPA1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P09661
Molecular weight:
22.33 kDa

Original price was: $299.00.Current price is: $230.00.

50ug 23% OFF + 230 loyalty points
Met1–Arg176
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SNRPA1 Protein, N-His

Product name ARO-P12136-100
Uniprot ID P09661
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIAR
Molecular weight 22.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg176
Aliases /Synonyms U2 small nuclear ribonucleoprotein A', SNRPA1, U2 snRNP A'
Reference ARO-P12136
Note For research use only.
Molecular Constructor
Met1–Arg176
Product name ARO-P12136-1MG
Uniprot ID P09661
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIAR
Molecular weight 22.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg176
Aliases /Synonyms U2 small nuclear ribonucleoprotein A', SNRPA1, U2 snRNP A'
Reference ARO-P12136
Note For research use only.
Molecular Constructor
Met1–Arg176
Product name ARO-P12136-50
Uniprot ID P09661
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIAR
Molecular weight 22.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg176
Aliases /Synonyms U2 small nuclear ribonucleoprotein A', SNRPA1, U2 snRNP A'
Reference ARO-P12136
Note For research use only.
Molecular Constructor
Met1–Arg176

Recombinant Human SNRPA1 Protein: Structure, Activity, and Applications

Introduction

Recombinant proteins have become an essential tool in various fields of research and industry. These proteins are produced through genetic engineering techniques, where the gene encoding the desired protein is inserted into a host cell and expressed to produce the protein of interest. One such recombinant protein is the Human SNRPA1 protein, which has a crucial role in RNA processing and splicing. In this article, we will discuss the structure, activity, and applications of Recombinant Human SNRPA1 protein.

Structure of Recombinant Human SNRPA1 Protein

The SNRPA1 gene encodes the small nuclear ribonucleoprotein polypeptide A (SNRPA1) protein, which is a component of the spliceosome complex. The protein consists of 282 amino acids and has a molecular weight of approximately 31 kDa. The primary structure of SNRPA1 protein is highly conserved among different species, indicating its essential role in cellular processes. The protein contains two RNA recognition motifs (RRMs) at its N-terminus, which are responsible for binding to RNA molecules. The C-terminal region of the protein contains a highly conserved glycine-rich domain, which is crucial for protein-protein interactions within the spliceosome complex.

Activity of Recombinant Human SNRPA1 Protein

The SNRPA1 protein plays a vital role in the splicing of pre-mRNA molecules, a process essential for the production of mature mRNA transcripts. The protein binds to the 5′ splice site of pre-mRNA, forming a complex with other proteins to initiate the splicing process. It also participates in the formation of the active spliceosome complex, which catalyzes the removal of introns and joining of exons to produce mature mRNA. Additionally, SNRPA1 protein is involved in the regulation of alternative splicing, which allows for the production of different mRNA isoforms from a single gene. This activity of SNRPA1 protein is crucial for maintaining proper gene expression and cellular function.

Applications of Recombinant Human SNRPA1 Protein

Recombinant Human SNRPA1 protein has various applications in both research and industry. One of the primary uses of this protein is in the study of RNA processing and splicing. Researchers can use recombinant SNRPA1 protein to investigate the role of this protein in different cellular processes and its interactions with other spliceosome components. The protein can also be used to study the effects of mutations in the SNRPA1 gene on splicing and gene expression.

In the biotechnology industry, recombinant SNRPA1 protein is used in the production of therapeutic proteins. The protein can be used as an antigen to induce an immune response in the production of monoclonal antibodies. It can also be used as a target for drug development, as mutations in the SNRPA1 gene have been associated with certain diseases, including autoimmune disorders and cancer. Furthermore, recombinant SNRPA1 protein can be used in the development of diagnostic tests for these diseases.

Conclusion

In conclusion, Recombinant Human SNRPA1 protein is a crucial component of the spliceosome complex, involved in the processing of pre-mRNA molecules. The protein’s structure, with its RNA binding motifs and glycine-rich domain, allows for its essential activity in splicing. Recombinant SNRPA1 protein has various applications in research and industry, making it a valuable tool in understanding RNA processing and its role in disease. Further studies on this protein may lead to new insights into its function and potential therapeutic applications.

Recombinant Human SNRPA1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SNRPA1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products