Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ARMC8 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8IUR7
Molecular weight:
43.05 kDa

Original price was: $383.00.Current price is: $327.00.

100ug 15% OFF + 327 loyalty points
Glu16–Lys378
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ARMC8 Protein, N-His

Product name ARO-P11917-100
Uniprot ID Q8IUR7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLLEERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKLYASLGANDEDIRKK
Molecular weight 43.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu16-Lys378
Aliases /Synonyms ARMC8, Armadillo repeat-containing protein 8
Reference ARO-P11917
Note For research use only.
Molecular Constructor
Glu16–Lys378
Product name ARO-P11917-1MG
Uniprot ID Q8IUR7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLLEERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKLYASLGANDEDIRKK
Molecular weight 43.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu16-Lys378
Aliases /Synonyms ARMC8, Armadillo repeat-containing protein 8
Reference ARO-P11917
Note For research use only.
Molecular Constructor
Glu16–Lys378
Product name ARO-P11917-50
Uniprot ID Q8IUR7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLLEERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKLYASLGANDEDIRKK
Molecular weight 43.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu16-Lys378
Aliases /Synonyms ARMC8, Armadillo repeat-containing protein 8
Reference ARO-P11917
Note For research use only.
Molecular Constructor
Glu16–Lys378

Introduction

Recombinant Human ARMC8 Protein (rARMC8) is a highly purified and biologically active protein that is produced through recombinant DNA technology. It is a member of the armadillo repeat-containing (ARMC) protein family and plays a crucial role in various cellular processes. In this article, we will discuss the structure, activity, and applications of rARMC8 protein.

Structure of rARMC8 Protein

The rARMC8 protein is composed of 350 amino acids and has a molecular weight of approximately 40 kDa. It contains a conserved N-terminal armadillo repeat domain, which is responsible for protein-protein interactions, and a C-terminal coiled-coil domain, which is involved in protein dimerization. The protein also has a nuclear localization signal, indicating its role in nuclear transport.

Activity of rARMC8 Protein

The main function of rARMC8 protein is to regulate the activity of the Wnt signaling pathway. This pathway plays a critical role in embryonic development, tissue homeostasis, and cell proliferation. rARMC8 protein interacts with other proteins in the pathway, such as β-catenin, to regulate the transcription of target genes. It has been shown that rARMC8 protein acts as a negative regulator of the Wnt pathway by promoting the degradation of β-catenin.

Moreover, rARMC8 protein has been found to be involved in cell cycle regulation. It interacts with the tumor suppressor protein p53 and regulates its activity, leading to cell cycle arrest and apoptosis. This suggests that rARMC8 protein may play a role in tumor growth and development.

Applications of rARMC8 Protein

Due to its involvement in the Wnt signaling pathway, rARMC8 protein has been studied in various disease models. It has been found to be dysregulated in several types of cancers, including breast, colon, and lung cancer. In addition, mutations in the ARMC8 gene have been linked to developmental disorders, such as Joubert syndrome and short rib-polydactyly syndrome.

The use of rARMC8 protein in research has also expanded to other areas, such as stem cell differentiation and tissue regeneration. It has been shown to play a role in the differentiation of mesenchymal stem cells into osteoblasts, which are responsible for bone formation. This suggests that rARMC8 protein may have potential applications in bone tissue engineering.

Furthermore, rARMC8 protein has been studied as a potential therapeutic target for diseases involving dysregulation of the Wnt pathway. Inhibitors of rARMC8 protein have been developed and tested in preclinical studies for their anti-tumor effects. These inhibitors have shown promising results in reducing tumor growth and improving survival rates in animal models.

Conclusion

In summary, rARMC8 protein is a crucial regulator of the Wnt signaling pathway and plays a role in various cellular processes. Its structure, activity, and applications have been extensively studied, and it has shown potential as a therapeutic target for diseases involving dysregulation of the Wnt pathway. Further research on rARMC8 protein may lead to the development of new treatments for cancer and other diseases.

Recombinant Human ARMC8 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ARMC8 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products