Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ATP5ME Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P56385
Molecular weight:
20.14 kDa

Original price was: $312.00.Current price is: $274.00.

50ug 12% OFF + 274 loyalty points
Val2–Lys69
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ATP5ME Protein, N-His-SUMO

Product name ARO-P10770-100
Uniprot ID P56385
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK
Molecular weight 20.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val2-Lys69
Aliases /Synonyms ATP5K, ATP5ME, ATPase subunit e, ATP synthase subunit e, mitochondrial, ATP synthase membrane subunit e, ATP5I
Reference ARO-P10770
Note For research use only.
Molecular Constructor
Val2–Lys69
Product name ARO-P10770-1MG
Uniprot ID P56385
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK
Molecular weight 20.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val2-Lys69
Aliases /Synonyms ATP5K, ATP5ME, ATPase subunit e, ATP synthase subunit e, mitochondrial, ATP synthase membrane subunit e, ATP5I
Reference ARO-P10770
Note For research use only.
Molecular Constructor
Val2–Lys69
Product name ARO-P10770-50
Uniprot ID P56385
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK
Molecular weight 20.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val2-Lys69
Aliases /Synonyms ATP5K, ATP5ME, ATPase subunit e, ATP synthase subunit e, mitochondrial, ATP synthase membrane subunit e, ATP5I
Reference ARO-P10770
Note For research use only.
Molecular Constructor
Val2–Lys69

Introduction

Recombinant Human ATP5ME Protein, also known as ATP synthase subunit epsilon, is a key enzyme involved in the production of ATP, the main source of energy for cellular processes. This protein is a crucial component of the mitochondrial ATP synthase complex, which is responsible for converting ADP to ATP through the process of oxidative phosphorylation. In this article, we will discuss the structure, activity, and applications of Recombinant Human ATP5ME Protein.

Structure of Recombinant Human ATP5ME Protein

The ATP5ME gene is located on chromosome 10 and encodes for a protein of 75 amino acids. The protein has a molecular weight of approximately 8.5 kDa and is composed of a single polypeptide chain. The crystal structure of Recombinant Human ATP5ME Protein has been determined, revealing a compact structure with a helix-turn-helix motif. This structure is essential for the protein’s function in the ATP synthase complex.

Activity of Recombinant Human ATP5ME Protein

The primary function of Recombinant Human ATP5ME Protein is to regulate the activity of ATP synthase. This protein is a subunit of the ATP synthase complex, which is composed of two main parts: the F1 portion, which is responsible for the synthesis of ATP, and the Fo portion, which provides the channel for protons to flow through. The ATP5ME protein is located in the F1 portion, where it acts as a regulatory subunit.

The activity of Recombinant Human ATP5ME Protein is crucial for the proper functioning of the ATP synthase complex. It plays a role in stabilizing the complex and regulating the activity of the catalytic subunits, which are responsible for ATP synthesis. This protein also helps in the assembly of the ATP synthase complex and is essential for maintaining its structural integrity.

Applications of Recombinant Human ATP5ME Protein

1. Production of Recombinant Protein

Recombinant Human ATP5ME Protein is widely used in the production of recombinant proteins. This protein is commonly used as a fusion partner to enhance the solubility and stability of the target protein. The fusion protein can then be purified using affinity chromatography, making it a valuable tool in protein purification.

2. Antigen for Antibody Production

Recombinant Human ATP5ME Protein is also used as an antigen for antibody production. Antibodies raised against this protein can be used in various applications, such as western blotting, ELISA, and immunohistochemistry. These antibodies can also be used to study the expression and localization of ATP5ME in different tissues and cells.

3. Study of Mitochondrial Dysfunction

Mutations in the ATP5ME gene have been linked to mitochondrial dysfunction, which can lead to various diseases, including neurodegenerative disorders. Recombinant Human ATP5ME Protein is used to study the role of this protein in mitochondrial function and dysfunction. It can also be used to investigate the effects of ATP5ME mutations on the activity of the ATP synthase complex.

4. Drug Discovery

The ATP synthase complex has been identified as a potential target for drug development. Recombinant Human ATP5ME Protein is used in drug discovery studies to screen for compounds that can modulate its activity. This protein is also used in high-throughput screening assays to identify potential inhibitors of ATP synthase.

Conclusion

In conclusion, Recombinant Human ATP5ME Protein is a crucial component of the ATP synthase complex, responsible for regulating its activity. This protein has various applications in the fields of protein production, antibody production, mitochondrial dysfunction studies, and drug discovery. Its structure and function make it a valuable tool in understanding the role of ATP synthase in cellular processes and its potential as a therapeutic target.

Recombinant Human ATP5ME Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human ATP5ME Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products