Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD156a/ADAM8 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P78325
Molecular weight:
23.85 kDa

Original price was: $296.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Arg200–Arg390
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD156a/ADAM8 Protein, N-His

Product name ARO-P10760-100
Uniprot ID P78325
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RYVELYVVVDNAEFQMLGSEAAVRHRVLEVVNHVDKLYQKLNFRVVLVGLEIWNSQDRFHVSPDPSVTLENLLTWQARQRTRRHLHDNVQLITGVDFTGTTVGFARVSAMCSHSSGAVNQDHSKNPVGVACTMAHEMGHNLGMDHDENVQGCRCQERFEAGRCIMAGSIGSSFPRMFSDCSQAYLESFLER
Molecular weight 23.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg200-Arg390
Aliases /Synonyms Disintegrin and metalloproteinase domain-containing protein 8, ADAM8, CD156a, MS2, Cell surface antigen MS2, ADAM 8
Reference ARO-P10760
Note For research use only.
Molecular Constructor
Arg200–Arg390
Product name ARO-P10760-1MG
Uniprot ID P78325
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RYVELYVVVDNAEFQMLGSEAAVRHRVLEVVNHVDKLYQKLNFRVVLVGLEIWNSQDRFHVSPDPSVTLENLLTWQARQRTRRHLHDNVQLITGVDFTGTTVGFARVSAMCSHSSGAVNQDHSKNPVGVACTMAHEMGHNLGMDHDENVQGCRCQERFEAGRCIMAGSIGSSFPRMFSDCSQAYLESFLER
Molecular weight 23.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg200-Arg390
Aliases /Synonyms Disintegrin and metalloproteinase domain-containing protein 8, ADAM8, CD156a, MS2, Cell surface antigen MS2, ADAM 8
Reference ARO-P10760
Note For research use only.
Molecular Constructor
Arg200–Arg390
Product name ARO-P10760-50
Uniprot ID P78325
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RYVELYVVVDNAEFQMLGSEAAVRHRVLEVVNHVDKLYQKLNFRVVLVGLEIWNSQDRFHVSPDPSVTLENLLTWQARQRTRRHLHDNVQLITGVDFTGTTVGFARVSAMCSHSSGAVNQDHSKNPVGVACTMAHEMGHNLGMDHDENVQGCRCQERFEAGRCIMAGSIGSSFPRMFSDCSQAYLESFLER
Molecular weight 23.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg200-Arg390
Aliases /Synonyms Disintegrin and metalloproteinase domain-containing protein 8, ADAM8, CD156a, MS2, Cell surface antigen MS2, ADAM 8
Reference ARO-P10760
Note For research use only.
Molecular Constructor
Arg200–Arg390

Introduction to Recombinant Human CD156a/ADAM8 Protein

Recombinant Human CD156a/ADAM8 Protein, also known as A Disintegrin and Metalloproteinase 8 (ADAM8), is a member of the ADAM family of proteins. It is a transmembrane protein that plays a crucial role in various cellular processes such as cell adhesion, migration, and signaling. This protein is encoded by the ADAM8 gene and is expressed in a variety of tissues, including immune cells, brain, and lung.

Structure of Recombinant Human CD156a/ADAM8 Protein

The Recombinant Human CD156a/ADAM8 Protein is a type I transmembrane protein with a molecular weight of approximately 82 kDa. It consists of several domains, including a pro-domain, metalloproteinase domain, disintegrin domain, cysteine-rich domain, and a transmembrane domain. The metalloproteinase domain is responsible for the proteolytic activity of ADAM8, while the disintegrin domain is involved in cell adhesion and binding to integrins.

Activity of Recombinant Human CD156a/ADAM8 Protein

Recombinant Human CD156a/ADAM8 Protein is a multifunctional protein with diverse activities. Its main function is to cleave and shed the extracellular domains of various cell surface proteins, such as growth factors, cytokines, and adhesion molecules. This proteolytic activity of ADAM8 is crucial in regulating cell signaling and communication between cells.

In addition to its proteolytic activity, ADAM8 also has cell adhesion properties. It can bind to integrins on the surface of cells, mediating cell-cell and cell-matrix interactions. This function is important in processes such as cell migration, invasion, and tissue remodeling.

Moreover, Recombinant Human CD156a/ADAM8 Protein is involved in the regulation of immune responses. It is expressed on the surface of immune cells, including T cells, B cells, and macrophages, and is involved in the activation and proliferation of these cells. ADAM8 has also been linked to the development of inflammatory diseases, making it a potential target for therapeutic interventions.

Application of Recombinant Human CD156a/ADAM8 Protein

Recombinant Human CD156a/ADAM8 Protein has various applications in both research and clinical settings. Its role in cell adhesion and signaling makes it a valuable tool for studying cellular processes and interactions. ADAM8 is also a potential biomarker for various diseases, including cancer, asthma, and rheumatoid arthritis, making it useful in diagnostic tests.

In addition, Recombinant Human CD156a/ADAM8 Protein has therapeutic potential. Its proteolytic activity makes it a potential target for the treatment of cancer, as it can cleave and inactivate growth factors and cytokines that promote tumor growth. Inhibition of ADAM8 has also been shown to reduce inflammation in models of asthma and arthritis, making it a potential target for the treatment of these conditions.

Conclusion

In conclusion, Recombinant Human CD156a/ADAM8 Protein is a multifunctional protein with important roles in cell adhesion, signaling, and immune regulation. Its structure, activity, and applications make it a valuable tool for studying cellular processes and a potential target for therapeutic interventions. Further research on ADAM8 is needed to fully understand its functions and potential in various diseases.

Recombinant Human CD156a/ADAM8 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CD156a/ADAM8 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products