Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD169/SIGLEC1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BZZ2
Molecular weight:
25.76 kDa

Original price was: $309.00.Current price is: $274.00.

50ug 11% OFF + 274 loyalty points
Gly34–Gly240
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD169/SIGLEC1, N-His

Product name ARO-P13124-100
Uniprot ID Q9BZZ2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GSCLLIPCIFSFPADVEVPDGITAIWYYDYSGQRQVVSHSADPKLVEARFRGRTEFMGNPEHRVCNLLLKDLQPEDSGSYNFRFEISEVNRWSDVKGTLVTVTEEPRVPTIASPVELLEGTEVDFNCSTPYVCLQEQVRLQWQGQDPARSVTFNSQKFEPTGVGHLETLHMAMSWQDHGRILRCQLSVANHRAQSEIHLQVKYAPKG
Molecular weight 25.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly34-Gly240
Aliases /Synonyms Siglec-1, CD169, SIGLEC1, SN, Sialic acid-binding Ig-like lectin 1, Sialoadhesin
Reference ARO-P13124
Note For research use only.
Molecular Constructor
Gly34–Gly240
Product name ARO-P13124-1MG
Uniprot ID Q9BZZ2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GSCLLIPCIFSFPADVEVPDGITAIWYYDYSGQRQVVSHSADPKLVEARFRGRTEFMGNPEHRVCNLLLKDLQPEDSGSYNFRFEISEVNRWSDVKGTLVTVTEEPRVPTIASPVELLEGTEVDFNCSTPYVCLQEQVRLQWQGQDPARSVTFNSQKFEPTGVGHLETLHMAMSWQDHGRILRCQLSVANHRAQSEIHLQVKYAPKG
Molecular weight 25.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly34-Gly240
Aliases /Synonyms Siglec-1, CD169, SIGLEC1, SN, Sialic acid-binding Ig-like lectin 1, Sialoadhesin
Reference ARO-P13124
Note For research use only.
Molecular Constructor
Gly34–Gly240
Product name ARO-P13124-50
Uniprot ID Q9BZZ2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GSCLLIPCIFSFPADVEVPDGITAIWYYDYSGQRQVVSHSADPKLVEARFRGRTEFMGNPEHRVCNLLLKDLQPEDSGSYNFRFEISEVNRWSDVKGTLVTVTEEPRVPTIASPVELLEGTEVDFNCSTPYVCLQEQVRLQWQGQDPARSVTFNSQKFEPTGVGHLETLHMAMSWQDHGRILRCQLSVANHRAQSEIHLQVKYAPKG
Molecular weight 25.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly34-Gly240
Aliases /Synonyms Siglec-1, CD169, SIGLEC1, SN, Sialic acid-binding Ig-like lectin 1, Sialoadhesin
Reference ARO-P13124
Note For research use only.
Molecular Constructor
Gly34–Gly240

Introduction

Recombinant Human CD169/SIGLEC1 is a protein that plays a crucial role in the immune system. It is a member of the sialic acid-binding immunoglobulin-like lectin (SIGLEC) family and is also known as sialoadhesin or Siglec-1. This protein is encoded by the SIGLEC1 gene and is expressed on the surface of certain immune cells, such as macrophages and dendritic cells. In this article, we will discuss the structure, activity, and applications of this important protein.

Structure of Recombinant Human CD169/SIGLEC1

Recombinant Human CD169/SIGLEC1 is a type I transmembrane protein, meaning it has both extracellular and intracellular domains. The extracellular domain is composed of an N-terminal Ig-like V-set domain, a mucin-like domain, and a C-terminal Ig-like C2-set domain. The V-set domain is responsible for binding to sialic acid, while the mucin-like domain provides flexibility to the protein. The C2-set domain is involved in protein-protein interactions.

The intracellular domain of Recombinant Human CD169/SIGLEC1 contains a tyrosine-based signaling motif, which is important for signal transduction and activation of downstream pathways. This motif is also involved in the internalization of the protein.

Activity of Recombinant Human CD169/SIGLEC1

Recombinant Human CD169/SIGLEC1 is primarily involved in the recognition and clearance of sialylated pathogens and damaged cells. Sialic acids are a type of sugar that is found on the surface of many pathogens and damaged cells. These sugars act as a “molecular signature” that helps the immune system identify and eliminate them.

Recombinant Human CD169/SIGLEC1 binds to sialic acids on the surface of pathogens and damaged cells through its V-set domain. This binding triggers the activation of downstream signaling pathways, leading to the internalization and degradation of the bound cells. This process is essential for the proper functioning of the immune system and helps protect the body from infections and diseases.

In addition to its role in pathogen recognition and clearance, Recombinant Human CD169/SIGLEC1 also plays a role in immune regulation. It has been shown to modulate the activity of other immune cells, such as T cells and B cells, by regulating their activation and proliferation.

Applications of Recombinant Human CD169/SIGLEC1

Due to its important role in the immune system, Recombinant Human CD169/SIGLEC1 has been studied extensively for its potential applications in various fields, including immunology, infectious diseases, and cancer.

One potential application of Recombinant Human CD169/SIGLEC1 is in the development of vaccines. By targeting sialic acid on the surface of pathogens, this protein can enhance the immune response to vaccines and improve their efficacy. It has also been studied as a potential target for immunotherapies, such as monoclonal antibodies, for the treatment of various diseases.

In infectious diseases, Recombinant Human CD169/SIGLEC1 has been shown to play a crucial role in the recognition and clearance of viral and bacterial infections. Therefore, it has been studied as a potential biomarker for the diagnosis and monitoring of these infections.

In cancer, Recombinant Human CD169/SIGLEC1 has been found to be overexpressed in certain types of tumors, such as breast cancer and melanoma. This makes it a potential target for cancer immunotherapies, as well as a biomarker for cancer diagnosis and prognosis.

Conclusion

In summary, Recombinant Human CD169/SIGLEC1 is an important protein involved in the immune system. Its structure, activity, and applications have been extensively studied, and it has shown potential in various fields, including immunology, infectious diseases, and cancer. Further research on this protein may lead to the development of new therapies and diagnostic tools for various diseases.

Recombinant Human CD169/SIGLEC1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CD169/SIGLEC1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products