Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD247/CD3Z Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P20963
Molecular weight:
41.21 kDa

Original price was: $347.00.Current price is: $274.00.

50ug 21% OFF + 274 loyalty points
Arg52–Arg164
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD247/CD3Z Protein, N-GST & C-His

Product name ARO-P12728-100
Uniprot ID P20963
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Molecular weight 41.21 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg52-Arg164
Aliases /Synonyms CD3Z, CD247, TCRZ, T-cell receptor T3 zeta chain, T3Z, T-cell surface glycoprotein CD3 zeta chain
Reference ARO-P12728
Note For research use only.
Molecular Constructor
Arg52–Arg164
Product name ARO-P12728-1MG
Uniprot ID P20963
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Molecular weight 41.21 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg52-Arg164
Aliases /Synonyms CD3Z, CD247, TCRZ, T-cell receptor T3 zeta chain, T3Z, T-cell surface glycoprotein CD3 zeta chain
Reference ARO-P12728
Note For research use only.
Molecular Constructor
Arg52–Arg164
Product name ARO-P12728-50
Uniprot ID P20963
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Molecular weight 41.21 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg52-Arg164
Aliases /Synonyms CD3Z, CD247, TCRZ, T-cell receptor T3 zeta chain, T3Z, T-cell surface glycoprotein CD3 zeta chain
Reference ARO-P12728
Note For research use only.
Molecular Constructor
Arg52–Arg164

Recombinant Human CD247/CD3Z Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human CD247/CD3Z Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products