Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CHRNA6 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q15825
Molecular weight:
23.98 kDa

Original price was: $470.00.Current price is: $392.00.

100ug 17% OFF + 392 loyalty points
Val55–Arg238
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CHRNA6 Protein, N-His

Product name ARO-P11267-100
Uniprot ID Q15825
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VSDPVTVHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRR
Molecular weight 23.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val55-Arg238
Aliases /Synonyms CHRNA6, Neuronal acetylcholine receptor subunit alpha-6
Reference ARO-P11267
Note For research use only.
Molecular Constructor
Val55–Arg238
Product name ARO-P11267-1MG
Uniprot ID Q15825
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VSDPVTVHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRR
Molecular weight 23.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val55-Arg238
Aliases /Synonyms CHRNA6, Neuronal acetylcholine receptor subunit alpha-6
Reference ARO-P11267
Note For research use only.
Molecular Constructor
Val55–Arg238
Product name ARO-P11267-50
Uniprot ID Q15825
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VSDPVTVHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRR
Molecular weight 23.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val55-Arg238
Aliases /Synonyms CHRNA6, Neuronal acetylcholine receptor subunit alpha-6
Reference ARO-P11267
Note For research use only.
Molecular Constructor
Val55–Arg238

Introduction to Recombinant Human CHRNA6 Protein

Recombinant Human CHRNA6 Protein is a type of protein that is produced through recombinant DNA technology. This protein is a member of the nicotinic acetylcholine receptor family and is encoded by the CHRNA6 gene. It is primarily found in the brain and is involved in various physiological processes, making it an important target for research and potential therapeutic applications.

Structure of Recombinant Human CHRNA6 Protein

The structure of Recombinant Human CHRNA6 Protein is similar to other members of the nicotinic acetylcholine receptor family. It is composed of five subunits, each containing four transmembrane domains. These subunits come together to form a central pore that allows the passage of ions, specifically sodium and calcium, across the cell membrane.

The CHRNA6 gene encodes for the alpha6 subunit of the nicotinic acetylcholine receptor, which is the primary subunit of Recombinant Human CHRNA6 Protein. This subunit is essential for the proper functioning of the receptor and is responsible for binding to acetylcholine, the neurotransmitter that activates the receptor.

Activity of Recombinant Human CHRNA6 Protein

Recombinant Human CHRNA6 Protein is primarily found in the brain, specifically in regions involved in cognitive function, addiction, and reward. It is a ligand-gated ion channel, meaning that it is activated by the binding of a specific molecule, in this case, acetylcholine.

When activated, Recombinant Human CHRNA6 Protein allows the passage of ions, specifically sodium and calcium, into the cell. This influx of ions leads to the generation of an electrical signal, which is essential for the proper functioning of the brain. This process is known as neurotransmission and is crucial for various physiological processes, including learning, memory, and motor control.

However, studies have also shown that Recombinant Human CHRNA6 Protein may play a role in addiction. Nicotine, a chemical found in tobacco products, can bind to Recombinant Human CHRNA6 Protein and activate it, leading to the release of dopamine, a neurotransmitter involved in reward and pleasure. This mechanism is believed to contribute to the addictive properties of nicotine and other substances that activate Recombinant Human CHRNA6 Protein.

Applications of Recombinant Human CHRNA6 Protein

Due to its role in various physiological processes and potential involvement in addiction, Recombinant Human CHRNA6 Protein has been the subject of numerous research studies. One potential application of this protein is in the development of drugs for the treatment of nicotine addiction. By targeting Recombinant Human CHRNA6 Protein, researchers hope to develop drugs that can block its activation by nicotine, reducing the rewarding effects of nicotine and potentially aiding in smoking cessation.

In addition, Recombinant Human CHRNA6 Protein has also been studied in relation to cognitive function and neurological disorders. Mutations in the CHRNA6 gene have been linked to certain neurological disorders, such as schizophrenia and epilepsy. By studying the structure and activity of Recombinant Human CHRNA6 Protein, researchers hope to gain a better understanding of these disorders and potentially develop new treatments.

Furthermore, Recombinant Human CHRNA6 Protein has also been used in research studies to investigate its role in cognitive function and addiction. By studying the effects of activating or blocking Recombinant Human CHRNA6 Protein, researchers can gain insight into its specific role in these processes and potentially identify new therapeutic targets.

Conclusion

Recombinant Human CHRNA6 Protein is an essential protein involved in various physiological processes, including neurotransmission, addiction, and cognitive function. Its structure and activity make it an important target for research and potential therapeutic applications. By understanding the structure and function of this protein, researchers hope to develop new treatments for addiction and neurological disorders, as

Recombinant Human CHRNA6 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CHRNA6 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products