Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human COQ9 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O75208
Molecular weight:
27.56 kDa

Original price was: $252.00.Current price is: $230.00.

50ug 9% OFF + 230 loyalty points
Ser95–Arg318
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human COQ9 Protein, N-His

Product name ARO-P11220-100
Uniprot ID O75208
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGKDGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILMLPHNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR
Molecular weight 27.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser95-Arg318
Aliases /Synonyms Ubiquinone biosynthesis protein COQ9, mitochondrial, C16orf49, COQ9
Reference ARO-P11220
Note For research use only.
Molecular Constructor
Ser95–Arg318
Product name ARO-P11220-1MG
Uniprot ID O75208
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGKDGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILMLPHNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR
Molecular weight 27.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser95-Arg318
Aliases /Synonyms Ubiquinone biosynthesis protein COQ9, mitochondrial, C16orf49, COQ9
Reference ARO-P11220
Note For research use only.
Molecular Constructor
Ser95–Arg318
Product name ARO-P11220-50
Uniprot ID O75208
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGKDGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILMLPHNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR
Molecular weight 27.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser95-Arg318
Aliases /Synonyms Ubiquinone biosynthesis protein COQ9, mitochondrial, C16orf49, COQ9
Reference ARO-P11220
Note For research use only.
Molecular Constructor
Ser95–Arg318

Introduction

Recombinant Human COQ9 Protein, also known as Coenzyme Q9 protein, is a highly conserved protein that plays a critical role in the biosynthesis of coenzyme Q (CoQ), an essential component of the mitochondrial respiratory chain. This protein is encoded by the COQ9 gene and is found in various tissues, including the brain, heart, and skeletal muscle. Recombinant Human COQ9 Protein is produced through recombinant DNA technology and has been extensively studied for its structure, activity, and potential applications in various fields.

Structure of Recombinant Human COQ9 Protein

Recombinant Human COQ9 Protein is a 28 kDa protein composed of 261 amino acids. It is a soluble protein with a hydrophilic N-terminal domain and a hydrophobic C-terminal domain. The N-terminal domain contains a highly conserved coenzyme Q-binding motif, while the C-terminal domain contains a transmembrane domain that anchors the protein to the inner mitochondrial membrane. The crystal structure of Recombinant Human COQ9 Protein has been determined, revealing a unique fold with a central helix surrounded by six antiparallel beta strands.

Activity of Recombinant Human COQ9 Protein

The primary function of Recombinant Human COQ9 Protein is to catalyze the formation of CoQ from 4-hydroxybenzoate and polyprenyl diphosphate. This reaction is the last step in the biosynthesis of CoQ, which is essential for the production of ATP in the mitochondria. Recombinant Human COQ9 Protein is also involved in the stabilization of other proteins in the CoQ biosynthetic pathway, such as COQ7 and COQ8. Additionally, studies have shown that Recombinant Human COQ9 Protein plays a role in maintaining mitochondrial function and protecting against oxidative stress.

Applications of Recombinant Human COQ9 Protein

Recombinant Human COQ9 Protein has a wide range of potential applications in various fields, including medicine, biotechnology, and agriculture. One of the most promising applications is in the treatment of CoQ deficiency syndromes, which are rare genetic disorders caused by mutations in genes involved in CoQ biosynthesis. Recombinant Human COQ9 Protein has shown promising results in restoring CoQ levels and improving mitochondrial function in patients with CoQ deficiency syndromes.

In addition, Recombinant Human COQ9 Protein has been used in biotechnology for the production of CoQ supplements and cosmetics. CoQ supplements have been shown to have antioxidant and anti-aging properties, making them popular in the health and wellness industry. Recombinant Human COQ9 Protein has also been used in the development of CoQ-based skincare products, as it has been shown to improve skin hydration and reduce signs of aging.

Furthermore, Recombinant Human COQ9 Protein has potential applications in agriculture, specifically in the production of genetically modified crops. CoQ is an important antioxidant in plants, and Recombinant Human COQ9 Protein has been shown to improve plant growth and stress tolerance. This could have significant implications for crop production and food security.

Conclusion

In summary, Recombinant Human COQ9 Protein is a crucial protein involved in the biosynthesis of CoQ. Its unique structure and activity make it a promising candidate for various applications in medicine, biotechnology, and agriculture. With ongoing research and development, Recombinant Human COQ9 Protein has the potential to make a significant impact in these fields and improve human health and well-being.

Recombinant Human COQ9 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human COQ9 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products