Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CTPS2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NRF8
Molecular weight:
35.43 kDa

Original price was: $380.00.Current price is: $327.00.

100ug 14% OFF + 327 loyalty points
Met1–Lys297
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CTPS2 Protein, N-His

Product name ARO-P11419-100
Uniprot ID Q9NRF8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAVQEWVMNQAKVPVDGNKEEPQICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQK
Molecular weight 35.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys297
Aliases /Synonyms CTPS2, CTP synthetase 2, UTP--ammonia ligase 2, CTP synthase 2
Reference ARO-P11419
Note For research use only.
Molecular Constructor
Met1–Lys297
Product name ARO-P11419-1MG
Uniprot ID Q9NRF8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAVQEWVMNQAKVPVDGNKEEPQICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQK
Molecular weight 35.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys297
Aliases /Synonyms CTPS2, CTP synthetase 2, UTP--ammonia ligase 2, CTP synthase 2
Reference ARO-P11419
Note For research use only.
Molecular Constructor
Met1–Lys297
Product name ARO-P11419-50
Uniprot ID Q9NRF8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAVQEWVMNQAKVPVDGNKEEPQICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQK
Molecular weight 35.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys297
Aliases /Synonyms CTPS2, CTP synthetase 2, UTP--ammonia ligase 2, CTP synthase 2
Reference ARO-P11419
Note For research use only.
Molecular Constructor
Met1–Lys297

Introduction

Recombinant Human CTPS2 Protein, also known as CTP synthetase 2, is a key enzyme involved in the synthesis of CTP (cytidine triphosphate), an essential nucleotide for DNA and RNA synthesis. This protein is encoded by the CTPS2 gene and is highly conserved across species, with 96% similarity between human and mouse CTPS2 proteins. Recombinant Human CTPS2 Protein is produced through recombinant DNA technology and has numerous applications in scientific research and drug development.

Structure of Recombinant Human CTPS2 Protein

The recombinant form of CTPS2 protein is a homotetramer, meaning it is composed of four identical subunits. Each subunit consists of 593 amino acids and has a molecular weight of approximately 66 kDa. The primary structure of CTPS2 protein is highly conserved, with the majority of variations occurring in the N-terminal region. The protein also contains several functional domains, including an ATP binding site, a glutamine amidotransferase (GAT) domain, and a CTP synthetase domain.

Activity of Recombinant Human CTPS2 Protein

The main function of CTPS2 protein is to catalyze the conversion of UTP (uridine triphosphate) and glutamine to CTP and glutamate, respectively. This reaction is essential for the production of CTP, which is an important nucleotide for DNA and RNA synthesis. CTPS2 protein is also involved in regulating the cellular levels of CTP, which is crucial for maintaining proper cell growth and proliferation.

In addition to its role in nucleotide synthesis, CTPS2 protein has been found to have other functions in the cell. Studies have shown that CTPS2 is involved in the regulation of cell cycle progression and apoptosis. It has also been linked to the development and progression of certain types of cancer, making it a potential target for cancer therapy.

Application of Recombinant Human CTPS2 Protein

Recombinant Human CTPS2 Protein has a wide range of applications in scientific research and drug development. One of the main uses of this protein is in the study of nucleotide metabolism and its role in various cellular processes. Researchers can use recombinant CTPS2 protein to investigate the effects of CTPS2 on cell growth, proliferation, and apoptosis.

Another important application of recombinant CTPS2 protein is in drug discovery and development. As CTPS2 has been implicated in cancer development, targeting this protein could potentially lead to the development of new anti-cancer drugs. Recombinant CTPS2 protein can be used in high-throughput screening assays to identify compounds that inhibit its activity, which can then be further developed into potential drug candidates.

Furthermore, recombinant CTPS2 protein has been used in the production of vaccines. CTPS2 has been identified as an antigen in certain types of cancer, and recombinant CTPS2 protein can be used to stimulate an immune response against cancer cells. This approach has shown promising results in preclinical studies and could potentially lead to the development of new cancer vaccines.

Conclusion

In summary, Recombinant Human CTPS2 Protein is a key enzyme involved in nucleotide synthesis and has multiple functions in the cell. Its highly conserved structure and important role in cellular processes make it a valuable tool for scientific research and drug development. With its diverse applications, recombinant CTPS2 protein has the potential to contribute to advancements in various fields, including cancer therapy and vaccine development.

Recombinant Human CTPS2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CTPS2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products