Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CXCR7/ACKR3 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P25106
Molecular weight:
16.82 kDa

Original price was: $309.00.Current price is: $274.00.

50ug 11% OFF + 274 loyalty points
Asp2–Ser41
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CXCR7/ACKR3 Protein, N-His-SUMO

Product name ARO-P10786-100
Uniprot ID P25106
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKS
Molecular weight 16.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp2-Ser41
Aliases /Synonyms CXCR-7, RDC1, C-X-C chemokine receptor type 7, RDC-1, Chemokine orphan receptor 1, G-protein coupled receptor 159, Atypical chemokine receptor 3, CMKOR1, CXCR7, GPR159, G-protein coupled receptor RDC1 homolog, ACKR3, CXC-R7
Reference ARO-P10786
Note For research use only.
Molecular Constructor
Asp2–Ser41
Product name ARO-P10786-1MG
Uniprot ID P25106
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKS
Molecular weight 16.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp2-Ser41
Aliases /Synonyms CXCR-7, RDC1, C-X-C chemokine receptor type 7, RDC-1, Chemokine orphan receptor 1, G-protein coupled receptor 159, Atypical chemokine receptor 3, CMKOR1, CXCR7, GPR159, G-protein coupled receptor RDC1 homolog, ACKR3, CXC-R7
Reference ARO-P10786
Note For research use only.
Molecular Constructor
Asp2–Ser41
Product name ARO-P10786-50
Uniprot ID P25106
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKS
Molecular weight 16.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp2-Ser41
Aliases /Synonyms CXCR-7, RDC1, C-X-C chemokine receptor type 7, RDC-1, Chemokine orphan receptor 1, G-protein coupled receptor 159, Atypical chemokine receptor 3, CMKOR1, CXCR7, GPR159, G-protein coupled receptor RDC1 homolog, ACKR3, CXC-R7
Reference ARO-P10786
Note For research use only.
Molecular Constructor
Asp2–Ser41

Introduction to Recombinant Human CXCR7/ACKR3 Protein

Recombinant Human CXCR7/ACKR3 Protein, also known as C-X-C chemokine receptor type 7 or atypical chemokine receptor 3, is a G protein-coupled receptor (GPCR) that plays a crucial role in immune response and inflammation. This protein is encoded by the CXCR7 gene and is expressed in various tissues, including the brain, heart, and lungs. Recombinant Human CXCR7/ACKR3 Protein is produced through recombinant DNA technology, making it a valuable tool for research and therapeutic applications.

Structure of Recombinant Human CXCR7/ACKR3 Protein

Recombinant Human CXCR7/ACKR3 Protein is a transmembrane protein that belongs to the chemokine receptor family. It consists of 352 amino acids and has a molecular weight of approximately 40 kDa. The protein has seven transmembrane domains, an extracellular N-terminus, and an intracellular C-terminus. The extracellular region contains three N-glycosylation sites, which are important for protein stability and function.

The intracellular region of Recombinant Human CXCR7/ACKR3 Protein contains several conserved motifs, including a DRY motif, which is involved in G protein coupling, and a C-terminal PDZ-binding motif, which is responsible for protein-protein interactions. These structural features are essential for the proper functioning of the protein and can be targeted for drug development.

Activity of Recombinant Human CXCR7/ACKR3 Protein

Recombinant Human CXCR7/ACKR3 Protein is a chemokine receptor that binds to specific chemokines, small signaling proteins that regulate immune cell migration and activation. This protein has a high affinity for the chemokines CXCL11 and CXCL12, also known as stromal cell-derived factor 1 (SDF-1). Binding of these chemokines to Recombinant Human CXCR7/ACKR3 Protein leads to the activation of downstream signaling pathways, including the G protein-coupled pathway and the β-arrestin pathway.

Through these pathways, Recombinant Human CXCR7/ACKR3 Protein plays a crucial role in immune cell recruitment and activation, as well as in the regulation of cell proliferation, survival, and migration. It also has a role in angiogenesis, the formation of new blood vessels, and is involved in the development of the cardiovascular and nervous systems.

Applications of Recombinant Human CXCR7/ACKR3 Protein

The unique structure and activity of Recombinant Human CXCR7/ACKR3 Protein make it a valuable tool for various research and therapeutic applications. One of its primary uses is in the study of chemokine signaling and immune response. Recombinant Human CXCR7/ACKR3 Protein can be used to investigate the role of this receptor in different diseases, such as cancer, inflammation, and cardiovascular disorders.

Moreover, Recombinant Human CXCR7/ACKR3 Protein can be used as an antigen to generate specific antibodies for research and diagnostic purposes. These antibodies can be used to detect the expression and localization of Recombinant Human CXCR7/ACKR3 Protein in different tissues and cell types. They can also be used in immunohistochemistry and flow cytometry assays to analyze the function of this protein in various physiological and pathological conditions.

In addition to research applications, Recombinant Human CXCR7/ACKR3 Protein has potential therapeutic applications. Due to its involvement in various diseases, this protein has been identified as a potential target for drug development. Several studies have shown that targeting Recombinant Human CXCR7/ACKR3 Protein can have anti-inflammatory, anti-tumor, and neuroprotective effects. Therefore, this protein can be used as a

Recombinant Human CXCR7/ACKR3 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CXCR7/ACKR3 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products