Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CYP46A1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y6A2
Molecular weight:
54.38 kDa

Original price was: $350.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
His45–Cys500
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CYP46A1 Protein, N-His

Product name ARO-P11712-100
Uniprot ID Q9Y6A2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HLPCFWKKDEVGGRVLQDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRPRGWQPAPPPPPC
Molecular weight 54.38 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His45-Cys500
Aliases /Synonyms Cholesterol 24-hydroxylase, Cholesterol 24-monooxygenase, CH24H, CYP46A1, Cytochrome P450 46A1, CYP46, Cholesterol 24S-hydroxylase
Reference ARO-P11712
Note For research use only.
Molecular Constructor
His45–Cys500
Product name ARO-P11712-1MG
Uniprot ID Q9Y6A2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HLPCFWKKDEVGGRVLQDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRPRGWQPAPPPPPC
Molecular weight 54.38 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His45-Cys500
Aliases /Synonyms Cholesterol 24-hydroxylase, Cholesterol 24-monooxygenase, CH24H, CYP46A1, Cytochrome P450 46A1, CYP46, Cholesterol 24S-hydroxylase
Reference ARO-P11712
Note For research use only.
Molecular Constructor
His45–Cys500
Product name ARO-P11712-50
Uniprot ID Q9Y6A2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HLPCFWKKDEVGGRVLQDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRPRGWQPAPPPPPC
Molecular weight 54.38 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His45-Cys500
Aliases /Synonyms Cholesterol 24-hydroxylase, Cholesterol 24-monooxygenase, CH24H, CYP46A1, Cytochrome P450 46A1, CYP46, Cholesterol 24S-hydroxylase
Reference ARO-P11712
Note For research use only.
Molecular Constructor
His45–Cys500

Introduction to Recombinant Human CYP46A1 Protein

Recombinant Human CYP46A1 Protein is a vital enzyme involved in cholesterol metabolism. This protein is a key player in the conversion of cholesterol into 24S-hydroxycholesterol, which is a form of cholesterol that can easily cross the blood-brain barrier and be eliminated from the central nervous system. The gene encoding this protein is located on chromosome 14 and mutations in this gene have been linked to various neurological disorders, making this protein a potential target for therapeutic interventions.

Structure of Recombinant Human CYP46A1 Protein

The recombinant form of CYP46A1 protein is produced through genetic engineering techniques in a laboratory setting. This allows for the production of large quantities of the protein in a controlled and reproducible manner. The protein is composed of 503 amino acids and has a molecular weight of approximately 57 kDa. It belongs to the cytochrome P450 superfamily and contains a heme prosthetic group, which is essential for its catalytic activity.

The three-dimensional structure of recombinant human CYP46A1 protein has been determined through X-ray crystallography. It consists of a single polypeptide chain folded into a compact structure with multiple alpha-helices and beta-sheets. The active site of the protein is located in a cavity formed by these secondary structures, allowing for efficient binding and catalysis of its substrate.

Activity of Recombinant Human CYP46A1 Protein

The primary function of recombinant human CYP46A1 protein is to catalyze the conversion of cholesterol into 24S-hydroxycholesterol. This reaction takes place in the endoplasmic reticulum of cells, particularly in the brain and liver. The enzyme uses molecular oxygen and NADPH as co-substrates to carry out the oxidation of cholesterol at the C24 position, resulting in the formation of 24S-hydroxycholesterol.

In addition to its role in cholesterol metabolism, recombinant human CYP46A1 protein has been found to have other enzymatic activities. It has been shown to metabolize other sterols such as 25-hydroxycholesterol and 27-hydroxycholesterol, as well as certain drugs and environmental toxins. This suggests that this protein may have a broader role in the detoxification of foreign compounds in the body.

Applications of Recombinant Human CYP46A1 Protein

The production of recombinant human CYP46A1 protein has opened up new opportunities for research and drug development. One of the main applications of this protein is in the study of cholesterol metabolism and its role in neurological disorders. Mutations in the CYP46A1 gene have been linked to Alzheimer’s disease, Parkinson’s disease, and other neurodegenerative disorders. By studying the activity and regulation of this protein, scientists hope to gain a better understanding of these diseases and potentially develop new treatments.

Another potential application of recombinant human CYP46A1 protein is in drug discovery and development. As mentioned earlier, this protein has been found to metabolize various drugs and environmental toxins. By studying its activity and substrate specificity, researchers can identify potential drug interactions and develop more effective and safer medications.

Conclusion

In summary, recombinant human CYP46A1 protein is a crucial enzyme involved in cholesterol metabolism and has potential implications in various neurological disorders. Its production through genetic engineering has allowed for a better understanding of its structure and function, as well as opened up new avenues for research and drug development. Further studies on this protein may lead to a better understanding of cholesterol metabolism and the development of new treatments for neurological diseases.

Recombinant Human CYP46A1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CYP46A1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products