Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DDX3X Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O00571
Molecular weight:
30.58 kDa

Original price was: $363.00.Current price is: $327.00.

100ug 10% OFF + 327 loyalty points
Glu161–Ser410
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DDX3X Protein, N-His

Product name ARO-P11851-100
Uniprot ID O00571
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGS
Molecular weight 30.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu161-Ser410
Aliases /Synonyms DEAD box, X isoform, CAP-Rf, DDX3, HLP2, DEAD box protein 3, X-chromosomal, DDX3X, ATP-dependent RNA helicase DDX3X, Helicase-like protein 2, DBX
Reference ARO-P11851
Note For research use only.
Molecular Constructor
Glu161–Ser410
Product name ARO-P11851-1MG
Uniprot ID O00571
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGS
Molecular weight 30.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu161-Ser410
Aliases /Synonyms DEAD box, X isoform, CAP-Rf, DDX3, HLP2, DEAD box protein 3, X-chromosomal, DDX3X, ATP-dependent RNA helicase DDX3X, Helicase-like protein 2, DBX
Reference ARO-P11851
Note For research use only.
Molecular Constructor
Glu161–Ser410
Product name ARO-P11851-50
Uniprot ID O00571
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGS
Molecular weight 30.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu161-Ser410
Aliases /Synonyms DEAD box, X isoform, CAP-Rf, DDX3, HLP2, DEAD box protein 3, X-chromosomal, DDX3X, ATP-dependent RNA helicase DDX3X, Helicase-like protein 2, DBX
Reference ARO-P11851
Note For research use only.
Molecular Constructor
Glu161–Ser410

Introduction

Recombinant Human DDX3X Protein, also known as DEAD box protein 3, is a highly conserved ATP-dependent RNA helicase that plays a crucial role in RNA metabolism. This protein is encoded by the DDX3X gene and is expressed in various tissues and cell types, making it a key player in many biological processes. In this article, we will explore the structure, activity, and applications of Recombinant Human DDX3X Protein.

Structure of Recombinant Human DDX3X Protein

Recombinant Human DDX3X Protein is a 662 amino acid protein with a molecular weight of approximately 74 kDa. It consists of two main domains, a DEAD-box helicase domain and a helicase C-terminal domain. The DEAD-box helicase domain contains the conserved motifs involved in ATP binding and hydrolysis, while the helicase C-terminal domain is involved in RNA binding and helicase activity.

The crystal structure of Recombinant Human DDX3X Protein has been determined, revealing a two-domain structure with a central cleft that can accommodate single-stranded RNA molecules. This structure allows the protein to bind to and unwind RNA molecules, making it an essential player in RNA metabolism.

Activity of Recombinant Human DDX3X Protein

Recombinant Human DDX3X Protein is an ATP-dependent RNA helicase, meaning it uses energy from ATP hydrolysis to unwind RNA molecules. This activity is crucial for various biological processes, including translation, RNA splicing, and RNA degradation. The protein binds to single-stranded RNA molecules and uses its helicase activity to disrupt the base pairing between nucleotides, resulting in the unwinding of the RNA molecule.

In addition to its helicase activity, Recombinant Human DDX3X Protein also has a role in protein-protein interactions. It has been shown to interact with various proteins involved in RNA metabolism, such as RNA polymerase II, eIF4E, and eIF4G. This interaction is essential for regulating gene expression and protein synthesis.

Applications of Recombinant Human DDX3X Protein

Recombinant Human DDX3X Protein has a wide range of applications in both basic research and clinical settings. Its role in RNA metabolism makes it a valuable tool for studying gene expression, RNA processing, and translation. The protein can be used in in vitro assays to study its helicase activity and interactions with other proteins.

In addition to its use in research, Recombinant Human DDX3X Protein has potential clinical applications. It has been found to play a role in various diseases, including cancer, viral infections, and neurodegenerative disorders. Targeting this protein could provide new therapeutic strategies for these diseases.

Furthermore, Recombinant Human DDX3X Protein has been identified as a potential antigen for vaccine development. Studies have shown that this protein can elicit a strong immune response and could be used as a target for developing vaccines against viral infections, including HIV and hepatitis C.

Conclusion

Recombinant Human DDX3X Protein is a highly conserved ATP-dependent RNA helicase that plays a crucial role in RNA metabolism. Its structure, activity, and applications make it a valuable tool for studying gene expression and protein synthesis. Furthermore, its potential clinical applications and use as an antigen for vaccine development highlight its significance in the field of biomedicine. Further research on this protein could provide valuable insights into its role in various diseases and open up new avenues for therapeutic interventions.

Recombinant Human DDX3X Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DDX3X Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products