Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human HPS6 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q86YV9
Molecular weight:
21.54 kDa

Original price was: $276.00.Current price is: $230.00.

50ug 17% OFF + 230 loyalty points
Thr371–Met454
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human HPS6 Protein, N-His-SUMO

Product name ARO-P11428-100
Uniprot ID Q86YV9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TRGNLRLLSALGLFCVGWEAPQGVELPSAKDLVFEEACGYYQRRSLRGAQLTPEELRHSSTFRAPQALASILQGHLPPSALLTM
Molecular weight 21.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr371-Met454
Aliases /Synonyms Ruby-eye protein homolog, HPS6, Ru, Hermansky-Pudlak syndrome 6 protein
Reference ARO-P11428
Note For research use only.
Molecular Constructor
Thr371–Met454
Product name ARO-P11428-1MG
Uniprot ID Q86YV9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TRGNLRLLSALGLFCVGWEAPQGVELPSAKDLVFEEACGYYQRRSLRGAQLTPEELRHSSTFRAPQALASILQGHLPPSALLTM
Molecular weight 21.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr371-Met454
Aliases /Synonyms Ruby-eye protein homolog, HPS6, Ru, Hermansky-Pudlak syndrome 6 protein
Reference ARO-P11428
Note For research use only.
Molecular Constructor
Thr371–Met454
Product name ARO-P11428-50
Uniprot ID Q86YV9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TRGNLRLLSALGLFCVGWEAPQGVELPSAKDLVFEEACGYYQRRSLRGAQLTPEELRHSSTFRAPQALASILQGHLPPSALLTM
Molecular weight 21.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr371-Met454
Aliases /Synonyms Ruby-eye protein homolog, HPS6, Ru, Hermansky-Pudlak syndrome 6 protein
Reference ARO-P11428
Note For research use only.
Molecular Constructor
Thr371–Met454

Introduction

Recombinant Human HPS6 Protein is a genetically engineered protein that is produced in a laboratory using recombinant DNA technology. It is derived from the human HPS6 gene, which encodes for the HPS6 protein. This protein plays a crucial role in the biogenesis of lysosome-related organelles, such as melanosomes and platelet dense granules.

Structure

The recombinant Human HPS6 Protein consists of 1,333 amino acids and has a molecular weight of approximately 150 kDa. It is composed of multiple domains, including a coiled-coil domain, a zinc finger domain, and a WD40 repeat domain. These domains are essential for the protein’s function in intracellular trafficking and membrane fusion.

Activity

The primary function of the recombinant Human HPS6 Protein is to regulate the formation and transport of lysosome-related organelles. It does so by interacting with other proteins, such as HPS3 and HPS1, to form the biogenesis of lysosome-related organelles complex-2 (BLOC-2). This complex is involved in the sorting and delivery of cargo proteins to their respective organelles.

Studies have also shown that the recombinant Human HPS6 Protein is involved in the regulation of melanosome maturation and melanin synthesis. It has been found to interact with melanosome-specific proteins, such as tyrosinase-related protein 1 (TYRP1) and tyrosinase, to facilitate the transport of melanin-producing enzymes to melanosomes.

Application

The recombinant Human HPS6 Protein has various applications in both research and clinical settings. One of its primary uses is in the study of lysosome-related organelle biogenesis and intracellular trafficking. Its ability to interact with other proteins and form complexes makes it a valuable tool in understanding the molecular mechanisms involved in these processes.

In addition, the recombinant Human HPS6 Protein has potential therapeutic applications. Mutations in the HPS6 gene have been linked to Hermansky-Pudlak syndrome type 6 (HPS6), a rare genetic disorder characterized by oculocutaneous albinism, bleeding disorders, and pulmonary fibrosis. The recombinant protein can be used to study the effects of these mutations and potentially develop treatments for HPS6.

Furthermore, the recombinant Human HPS6 Protein can also be used in the development of diagnostic tests for HPS6 and other lysosomal storage disorders. Its specific interactions with other proteins and its role in lysosome-related organelle biogenesis make it a potential biomarker for these conditions.

Conclusion

In summary, the recombinant Human HPS6 Protein is a crucial component in the biogenesis of lysosome-related organelles and plays a significant role in intracellular trafficking. Its structure, activity, and various applications make it a valuable tool in both research and clinical settings. Further studies on this protein can provide a better understanding of its function and potential therapeutic uses.

Recombinant Human HPS6 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human HPS6 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products