Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DOCK4, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8N1I0
Molecular weight:
37.29 kDa

Original price was: $294.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Met1–Pro300
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DOCK4, N-His

Product name ARO-P13254-100
Uniprot ID Q8N1I0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MWIPTEHEKYGVVIASFRGTVPYGLSLEIGDTVQILEKCDGWYRGFALKNPNIKGIFPSSYVHLKNACVKNKGQFEMVIPTEDSVITEMTSTLRDWGTMWKQLYVRNEGDLFHRLWHIMNEILDLRRQVLVGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKEYAMVDPEDISITELYRLMEHRHRKKDTPVQASSHHLFVQMKSLMCSNLGEELEVIFSLFDSKENRPISERFFLRLNRNGLPKAPDKPERHCSLFVDLGSSELRKDIYITVHIIRIGRMGAGEKKNACSVQYRRP
Molecular weight 37.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro300
Aliases /Synonyms DOCK4, KIAA0716, Dedicator of cytokinesis protein 4
Reference ARO-P13254
Note For research use only.
Molecular Constructor
Met1–Pro300
Product name ARO-P13254-1MG
Uniprot ID Q8N1I0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MWIPTEHEKYGVVIASFRGTVPYGLSLEIGDTVQILEKCDGWYRGFALKNPNIKGIFPSSYVHLKNACVKNKGQFEMVIPTEDSVITEMTSTLRDWGTMWKQLYVRNEGDLFHRLWHIMNEILDLRRQVLVGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKEYAMVDPEDISITELYRLMEHRHRKKDTPVQASSHHLFVQMKSLMCSNLGEELEVIFSLFDSKENRPISERFFLRLNRNGLPKAPDKPERHCSLFVDLGSSELRKDIYITVHIIRIGRMGAGEKKNACSVQYRRP
Molecular weight 37.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro300
Aliases /Synonyms DOCK4, KIAA0716, Dedicator of cytokinesis protein 4
Reference ARO-P13254
Note For research use only.
Molecular Constructor
Met1–Pro300
Product name ARO-P13254-50
Uniprot ID Q8N1I0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MWIPTEHEKYGVVIASFRGTVPYGLSLEIGDTVQILEKCDGWYRGFALKNPNIKGIFPSSYVHLKNACVKNKGQFEMVIPTEDSVITEMTSTLRDWGTMWKQLYVRNEGDLFHRLWHIMNEILDLRRQVLVGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKEYAMVDPEDISITELYRLMEHRHRKKDTPVQASSHHLFVQMKSLMCSNLGEELEVIFSLFDSKENRPISERFFLRLNRNGLPKAPDKPERHCSLFVDLGSSELRKDIYITVHIIRIGRMGAGEKKNACSVQYRRP
Molecular weight 37.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro300
Aliases /Synonyms DOCK4, KIAA0716, Dedicator of cytokinesis protein 4
Reference ARO-P13254
Note For research use only.
Molecular Constructor
Met1–Pro300

Title: Introduction to Recombinant Human DOCK4

Recombinant Human DOCK4 is a protein that plays a crucial role in cell signaling and has been widely studied for its potential therapeutic applications. This protein is encoded by the DOCK4 gene and is a member of the DOCK family of proteins. In this article, we will explore the structure, activity, and potential applications of Recombinant Human DOCK4.

Title: Structure of Recombinant Human DOCK4

Recombinant Human DOCK4 is a large protein consisting of 2,487 amino acids with a molecular weight of approximately 280 kDa. It contains several conserved domains, including the DHR-1 and DHR-2 domains, which are responsible for its GTPase activity. The DHR-1 domain is involved in guanine nucleotide exchange, while the DHR-2 domain is responsible for binding to phospholipids.

Title: Activity of Recombinant Human DOCK4

Recombinant Human DOCK4 is a guanine nucleotide exchange factor (GEF) that activates the small GTPase protein Rac1. GEFs are important regulators of cell signaling pathways and play a crucial role in cell proliferation, migration, and invasion. DOCK4 specifically activates Rac1, which in turn activates downstream signaling pathways involved in cell adhesion, cytoskeletal reorganization, and gene expression.

Title: Role of Recombinant Human DOCK4 in Cancer

The activity of Recombinant Human DOCK4 is closely linked to cancer progression. Studies have shown that DOCK4 is overexpressed in various types of cancer, including breast, lung, and colon cancer. Overexpression of DOCK4 has been associated with increased cell proliferation, migration, and invasion, making it a potential therapeutic target for cancer treatment.

Title: Potential Applications of Recombinant Human DOCK4

Recombinant Human DOCK4 has been extensively studied for its potential therapeutic applications. One of the most promising applications is in cancer treatment. Inhibiting DOCK4 activity could potentially slow down cancer progression and inhibit metastasis. Additionally, DOCK4 has also been implicated in other diseases, such as cardiovascular diseases and neurological disorders, making it a potential target for therapeutic intervention in these conditions.

Title: Production of Recombinant Human DOCK4

Recombinant Human DOCK4 can be produced in various expression systems, including bacterial, yeast, and mammalian cells. The most commonly used system is the Chinese hamster ovary (CHO) cell line, which allows for proper post-translational modifications and yields a highly pure and active protein. The protein is then purified using chromatography techniques, ensuring its quality and activity for further studies and applications.

Title: Use of Recombinant Human DOCK4 as an Antigen

Recombinant Human DOCK4 has also been used as an antigen in immunological studies. Antibodies against DOCK4 have been developed and used to detect its expression in different tissues and cell types. Furthermore, DOCK4 has been identified as a potential antigen for cancer immunotherapy, where it could be targeted by specific antibodies to inhibit its activity and slow down cancer progression.

In conclusion, Recombinant Human DOCK4 is a crucial protein involved in cell signaling and has been extensively studied for its potential therapeutic applications. Its structure, activity, and potential applications make it a promising target for cancer treatment and other diseases. With further research and development, Recombinant Human DOCK4 could potentially be used as a diagnostic marker and a therapeutic agent in various diseases.

Recombinant Human DOCK4, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DOCK4, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products