Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DTX4 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y2E6
Molecular weight:
28.03 kDa

Original price was: $287.00.Current price is: $230.00.

50ug 20% OFF + 230 loyalty points
Gly387–Asp619
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DTX4 Protein, N-His

Product name ARO-P12068-100
Uniprot ID Q9Y2E6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GKTPEEVLKKYLQKVRHPPDEDCTICMERLTAPSGYKGPQPTVKPDLVGKLSRCGHVYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPPGKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKGRKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTAQEKD
Molecular weight 28.03 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly387-Asp619
Aliases /Synonyms RING finger protein 155, Protein deltex-4, RNF155, KIAA0937, RING-type E3 ubiquitin transferase DTX4, E3 ubiquitin-protein ligase DTX4, DTX4, Deltex4
Reference ARO-P12068
Note For research use only.
Molecular Constructor
Gly387–Asp619
Product name ARO-P12068-1MG
Uniprot ID Q9Y2E6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GKTPEEVLKKYLQKVRHPPDEDCTICMERLTAPSGYKGPQPTVKPDLVGKLSRCGHVYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPPGKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKGRKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTAQEKD
Molecular weight 28.03 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly387-Asp619
Aliases /Synonyms RING finger protein 155, Protein deltex-4, RNF155, KIAA0937, RING-type E3 ubiquitin transferase DTX4, E3 ubiquitin-protein ligase DTX4, DTX4, Deltex4
Reference ARO-P12068
Note For research use only.
Molecular Constructor
Gly387–Asp619
Product name ARO-P12068-50
Uniprot ID Q9Y2E6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GKTPEEVLKKYLQKVRHPPDEDCTICMERLTAPSGYKGPQPTVKPDLVGKLSRCGHVYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPPGKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKGRKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTAQEKD
Molecular weight 28.03 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly387-Asp619
Aliases /Synonyms RING finger protein 155, Protein deltex-4, RNF155, KIAA0937, RING-type E3 ubiquitin transferase DTX4, E3 ubiquitin-protein ligase DTX4, DTX4, Deltex4
Reference ARO-P12068
Note For research use only.
Molecular Constructor
Gly387–Asp619

Introduction

Recombinant proteins have become essential tools in various fields of research and medicine due to their ability to mimic naturally occurring proteins and perform specific functions. One such protein is the Recombinant Human DTX4 Protein, which has gained significant attention in recent years for its diverse applications in immunology, cancer research, and drug development. In this article, we will delve into the structure, activity, and application of this important protein.

Structure of Recombinant Human DTX4 Protein

The Recombinant Human DTX4 Protein is a member of the Deltex family of E3 ubiquitin ligases. It is encoded by the DTX4 gene located on chromosome 5q31.1 in humans. The protein consists of 625 amino acids and has a molecular weight of approximately 70 kDa. It contains a conserved N-terminal WWE domain, which is responsible for protein-protein interactions, and a C-terminal RING finger domain, which is essential for its E3 ubiquitin ligase activity.

The crystal structure of Recombinant Human DTX4 Protein has been determined, revealing a compact globular structure with a central core formed by the WWE and RING finger domains. The protein also contains several flexible loops and helices, which are crucial for its function as an E3 ubiquitin ligase.

Activity of Recombinant Human DTX4 Protein

The primary function of Recombinant Human DTX4 Protein is to act as an E3 ubiquitin ligase, which is a crucial component of the ubiquitin-proteasome system. This system plays a key role in protein degradation and turnover, as well as in regulating various cellular processes, including cell cycle progression, DNA repair, and immune response.

As an E3 ubiquitin ligase, Recombinant Human DTX4 Protein binds to specific target proteins and facilitates the transfer of ubiquitin molecules to these proteins. This process marks the target proteins for degradation by the proteasome, thus regulating their abundance and activity. Recombinant Human DTX4 Protein has been shown to target several proteins involved in immune signaling, such as Notch receptors, Toll-like receptors, and NF-κB signaling proteins.

Application of Recombinant Human DTX4 Protein

Recombinant Human DTX4 Protein has been widely used in various research fields, including immunology, cancer biology, and drug development. Its ability to regulate immune signaling pathways has made it a valuable tool in studying the immune response and developing immunotherapies.

In cancer research, Recombinant Human DTX4 Protein has been shown to play a role in tumor growth and metastasis by regulating the activity of Notch signaling, which is known to be dysregulated in many types of cancer. Additionally, its E3 ubiquitin ligase activity has been targeted for the development of novel cancer therapeutics.

Furthermore, Recombinant Human DTX4 Protein has been used in drug discovery and development as a potential drug target or as a tool for screening potential drug candidates. Its role in regulating immune signaling makes it a promising target for the development of immunomodulatory drugs for various diseases.

Conclusion

In summary, Recombinant Human DTX4 Protein is a crucial protein with a well-defined structure and activity. Its role as an E3 ubiquitin ligase and its involvement in regulating immune signaling pathways make it an important protein in various fields of research and medicine. With its diverse applications and potential as a drug target, Recombinant Human DTX4 Protein continues to be a subject of interest for scientists and researchers.

Recombinant Human DTX4 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DTX4 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products