Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human EEA1 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q15075
Molecular weight:
23.27 kDa

Original price was: $262.00.Current price is: $230.00.

50ug 12% OFF + 230 loyalty points
Ala1325–Gly1411
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human EEA1 Protein, N-His-SUMO & C-Strep

Product name ARO-P11219-100
Uniprot ID Q15075
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Molecular weight 23.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala1325-Gly1411
Aliases /Synonyms EEA1, Endosome-associated protein p162, Zinc finger FYVE domain-containing protein 2, ZFYVE2, Early endosome antigen 1
Reference ARO-P11219
Note For research use only.
Molecular Constructor
Ala1325–Gly1411
Product name ARO-P11219-1MG
Uniprot ID Q15075
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Molecular weight 23.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala1325-Gly1411
Aliases /Synonyms EEA1, Endosome-associated protein p162, Zinc finger FYVE domain-containing protein 2, ZFYVE2, Early endosome antigen 1
Reference ARO-P11219
Note For research use only.
Molecular Constructor
Ala1325–Gly1411
Product name ARO-P11219-50
Uniprot ID Q15075
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Molecular weight 23.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala1325-Gly1411
Aliases /Synonyms EEA1, Endosome-associated protein p162, Zinc finger FYVE domain-containing protein 2, ZFYVE2, Early endosome antigen 1
Reference ARO-P11219
Note For research use only.
Molecular Constructor
Ala1325–Gly1411

Introduction

Recombinant Human EEA1 Protein, also known as Early Endosome Antigen 1, is a protein that plays a crucial role in the endocytic pathway and is essential for the proper functioning of early endosomes. This protein is encoded by the EEA1 gene and is highly conserved among different species, including humans. Recombinant Human EEA1 Protein is widely used in research and diagnostic applications due to its structural and functional characteristics.

Structure of Recombinant Human EEA1 Protein

Recombinant Human EEA1 Protein is a 162 kDa protein consisting of 1412 amino acids. It contains a N-terminal FYVE zinc finger domain, a central coiled-coil domain, and a C-terminal WD40 repeat domain. The FYVE domain is responsible for binding to phosphatidylinositol 3-phosphate (PI3P) on the early endosome membrane, while the WD40 repeat domain is involved in protein-protein interactions.

Activity of Recombinant Human EEA1 Protein

Recombinant Human EEA1 Protein plays a crucial role in the endocytic pathway by regulating the maturation of early endosomes. It is involved in the recruitment and fusion of early endosomes with late endosomes and lysosomes, which is essential for the degradation of internalized material. This protein also plays a role in the intracellular trafficking of proteins, lipids, and other molecules.

The FYVE domain of Recombinant Human EEA1 Protein binds to PI3P on the early endosome membrane, which is essential for the recruitment of other proteins and the formation of endosomal tubules. This allows for the proper sorting and transport of cargo molecules within the endocytic pathway. The coiled-coil domain of this protein is responsible for its dimerization, which is necessary for its function.

Applications of Recombinant Human EEA1 Protein

Recombinant Human EEA1 Protein is widely used in research and diagnostic applications due to its crucial role in the endocytic pathway. Some of the specific applications of this protein are:

1. Study of endosomal trafficking

Recombinant Human EEA1 Protein is commonly used in studies to understand the mechanisms of endosomal trafficking and its role in various cellular processes. Its ability to bind to PI3P and regulate the maturation of early endosomes makes it a valuable tool for studying the dynamics of endosomal compartments.

2. Investigation of diseases

Defects in the endocytic pathway have been linked to various diseases, including neurodegenerative disorders and cancer. Recombinant Human EEA1 Protein is used in research to investigate the role of endosomal trafficking in these diseases and to identify potential therapeutic targets.

3. Biomarker for cancer diagnosis

Recent studies have shown that EEA1 is overexpressed in certain types of cancer, including breast and lung cancer. Recombinant Human EEA1 Protein can be used as a biomarker to detect the presence of these cancers and monitor their progression.

4. Development of therapeutic agents

The crucial role of Recombinant Human EEA1 Protein in the endocytic pathway makes it a potential target for the development of therapeutic agents. By understanding its structure and activity, researchers can design molecules that can modulate its function and potentially treat diseases associated with defects in the endocytic pathway.

Conclusion

Recombinant Human EEA1 Protein is a crucial protein involved in the endocytic pathway and has various applications in research and diagnostics. Its structural and functional characteristics make it a valuable tool for studying endosomal trafficking and identifying potential therapeutic targets for diseases. With ongoing research, this protein is expected to have even more significant implications in the future.

Recombinant Human EEA1 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human EEA1 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products