Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ATP6V0A1 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q93050
Molecular weight:
22.48 kDa

Original price was: $280.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Arg167–Arg241
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ATP6V0A1 Protein, N-His-SUMO & C-Strep

Product name ARO-P11720-100
Uniprot ID Q93050
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIFFQGDQLKNRVKKICEGFR
Molecular weight 22.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg167-Arg241
Aliases /Synonyms V-ATPase 116 kDa subunit a1, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1, ATP6V0A1, V-type proton ATPase 116 kDa subunit a1, ATP6N1, Vacuolar proton pump subunit 1, VPP1, Vacuolar adenosine triphosphatase subunit Ac116, Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit, ATP6N1A
Reference ARO-P11720
Note For research use only.
Molecular Constructor
Arg167–Arg241
Product name ARO-P11720-1MG
Uniprot ID Q93050
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIFFQGDQLKNRVKKICEGFR
Molecular weight 22.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg167-Arg241
Aliases /Synonyms V-ATPase 116 kDa subunit a1, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1, ATP6V0A1, V-type proton ATPase 116 kDa subunit a1, ATP6N1, Vacuolar proton pump subunit 1, VPP1, Vacuolar adenosine triphosphatase subunit Ac116, Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit, ATP6N1A
Reference ARO-P11720
Note For research use only.
Molecular Constructor
Arg167–Arg241
Product name ARO-P11720-50
Uniprot ID Q93050
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIFFQGDQLKNRVKKICEGFR
Molecular weight 22.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg167-Arg241
Aliases /Synonyms V-ATPase 116 kDa subunit a1, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1, ATP6V0A1, V-type proton ATPase 116 kDa subunit a1, ATP6N1, Vacuolar proton pump subunit 1, VPP1, Vacuolar adenosine triphosphatase subunit Ac116, Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit, ATP6N1A
Reference ARO-P11720
Note For research use only.
Molecular Constructor
Arg167–Arg241

Introduction

Recombinant Human ATP6V0A1 Protein, also known as V-type proton ATPase subunit a 1, is a protein that plays a crucial role in the functioning of the V-ATPase complex. This complex is responsible for maintaining the acidic pH of intracellular compartments, which is essential for various cellular processes such as protein degradation, neurotransmitter uptake, and ion transport. In this article, we will discuss the structure, activity, and applications of Recombinant Human ATP6V0A1 Protein.

Structure of Recombinant Human ATP6V0A1 Protein

The ATP6V0A1 gene encodes for a protein of 1161 amino acids, with a predicted molecular weight of approximately 130 kDa. The protein consists of two main subunits, a large V0 domain and a smaller V1 domain, which are connected by a central stalk. The V0 domain is responsible for proton translocation, while the V1 domain is involved in ATP hydrolysis. The V0 domain contains six subunits, including ATP6V0A1, while the V1 domain contains eight subunits.

Activity of Recombinant Human ATP6V0A1 Protein

The main function of Recombinant Human ATP6V0A1 Protein is to form the V-ATPase complex, which is responsible for maintaining the acidic pH of intracellular compartments. This is achieved by pumping protons from the cytoplasm into the lumen of the compartment, creating an electrochemical gradient. This gradient is then used by other transporters to transport various molecules, such as neurotransmitters and ions, across the membrane.

In addition to its role in maintaining pH, Recombinant Human ATP6V0A1 Protein also plays a crucial role in protein degradation. The V-ATPase complex is responsible for the acidification of lysosomes, which are organelles involved in the breakdown of cellular waste and foreign substances. The low pH in lysosomes is essential for the activity of enzymes involved in degradation.

Applications of Recombinant Human ATP6V0A1 Protein

Recombinant Human ATP6V0A1 Protein has a wide range of applications in both research and therapeutic settings. One of its main uses is in studying the structure and function of the V-ATPase complex. Recombinant protein can be produced in large quantities and used for biochemical and structural studies, such as X-ray crystallography and cryo-electron microscopy.

In addition to research, Recombinant Human ATP6V0A1 Protein has potential therapeutic applications. Mutations in the ATP6V0A1 gene have been linked to various diseases, such as osteopetrosis, renal tubular acidosis, and neurodegenerative disorders. Recombinant protein can be used to study the effects of these mutations and develop potential treatments.

Furthermore, Recombinant Human ATP6V0A1 Protein can also be used as an antigen in vaccine development. The V-ATPase complex has been shown to be a potential target for immune responses, and Recombinant Human ATP6V0A1 Protein can be used to induce an immune response against the complex. This could lead to the development of vaccines against diseases caused by V-ATPase dysfunction, such as osteopetrosis.

In conclusion

Recombinant Human ATP6V0A1 Protein is a crucial component of the V-ATPase complex, responsible for maintaining the acidic pH of intracellular compartments. Its structure and activity make it an essential protein in various cellular processes, and its potential applications in research and therapy make it a valuable tool in the scientific community. Further studies on Recombinant Human ATP6V0A1 Protein could lead to a better understanding of its role in health and disease and the development of new treatments.

Recombinant Human ATP6V0A1 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human ATP6V0A1 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products