Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CDCA7 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BWT1
Molecular weight:
16.78 kDa

Original price was: $343.00.Current price is: $274.00.

50ug 20% OFF + 274 loyalty points
Thr246–Ala371
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CDCA7 Protein, N-His

Product name ARO-P11164-100
Uniprot ID Q9BWT1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TEEELENVCSNSREKIYNRSLGSTCHQCRQKTIDTKTNCRNPDCWGVRGQFCGPCLRNRYGEEVRDALLDPNWHCPPCRGICNCSFCRQRDGRCATGVLVYLAKYHGFGNVHAYLKSLKQEFEMQA
Molecular weight 16.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr246-Ala371
Aliases /Synonyms CDCA7, JPO1, Cell division cycle-associated protein 7, Protein JPO1
Reference ARO-P11164
Note For research use only.
Molecular Constructor
Thr246–Ala371
Product name ARO-P11164-1MG
Uniprot ID Q9BWT1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TEEELENVCSNSREKIYNRSLGSTCHQCRQKTIDTKTNCRNPDCWGVRGQFCGPCLRNRYGEEVRDALLDPNWHCPPCRGICNCSFCRQRDGRCATGVLVYLAKYHGFGNVHAYLKSLKQEFEMQA
Molecular weight 16.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr246-Ala371
Aliases /Synonyms CDCA7, JPO1, Cell division cycle-associated protein 7, Protein JPO1
Reference ARO-P11164
Note For research use only.
Molecular Constructor
Thr246–Ala371
Product name ARO-P11164-50
Uniprot ID Q9BWT1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TEEELENVCSNSREKIYNRSLGSTCHQCRQKTIDTKTNCRNPDCWGVRGQFCGPCLRNRYGEEVRDALLDPNWHCPPCRGICNCSFCRQRDGRCATGVLVYLAKYHGFGNVHAYLKSLKQEFEMQA
Molecular weight 16.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr246-Ala371
Aliases /Synonyms CDCA7, JPO1, Cell division cycle-associated protein 7, Protein JPO1
Reference ARO-P11164
Note For research use only.
Molecular Constructor
Thr246–Ala371

Introduction to Recombinant Human CDCA7 Protein

Recombinant Human CDCA7 Protein, also known as Cell Division Cycle Associated 7 Protein, is a highly conserved protein that plays a crucial role in cell cycle regulation and cell proliferation. It is a recombinant protein that has been produced through genetic engineering techniques, making it a valuable tool for various scientific and medical applications.

Structure of Recombinant Human CDCA7 Protein

Recombinant Human CDCA7 Protein is a 54 kDa protein that consists of 491 amino acids. It is composed of two main domains: an N-terminal domain and a C-terminal domain. The N-terminal domain contains a nuclear localization signal, which is responsible for the protein’s localization to the nucleus. The C-terminal domain contains a DNA-binding domain, which allows the protein to interact with specific DNA sequences.

Activity of Recombinant Human CDCA7 Protein

Recombinant Human CDCA7 Protein is a transcription factor that regulates the expression of various genes involved in cell cycle progression and cell proliferation. It has been shown to interact with other proteins, such as E2F transcription factors, to form a complex that binds to specific DNA sequences and regulates gene expression.

Studies have also shown that Recombinant Human CDCA7 Protein is involved in the regulation of chromatin structure and function. It can interact with histone deacetylases (HDACs) and histone acetyltransferases (HATs) to modulate the acetylation status of histones, which plays a crucial role in gene expression.

Application of Recombinant Human CDCA7 Protein

Recombinant Human CDCA7 Protein has a wide range of applications in scientific research and medical fields. Some of its key applications include:

1. Cancer Research

Recombinant Human CDCA7 Protein has been extensively studied in the context of cancer research. It has been found to be overexpressed in various types of cancer, such as breast cancer, lung cancer, and leukemia. Its overexpression has been linked to increased cell proliferation and tumor growth. Therefore, it is being investigated as a potential therapeutic target for cancer treatment.

2. Cell Cycle Regulation

As a key regulator of cell cycle progression, Recombinant Human CDCA7 Protein is being studied for its role in cell cycle regulation. It has been shown to interact with other proteins, such as cyclins and cyclin-dependent kinases, to control the progression of the cell cycle. This makes it a valuable tool for understanding the mechanisms of cell cycle regulation and potential therapeutic interventions for diseases caused by cell cycle dysregulation.

3. Biomarker for Disease Diagnosis

The overexpression of Recombinant Human CDCA7 Protein has been observed in various diseases, including cancer and neurodegenerative disorders. This makes it a potential biomarker for disease diagnosis and prognosis. Its levels in biological samples, such as blood or tissue, can be measured to identify disease states and monitor disease progression.

4. Drug Target Identification

Recombinant Human CDCA7 Protein is being studied as a potential drug target for various diseases. By understanding its role in disease processes, researchers can identify compounds that can modulate its activity and potentially treat the disease. This makes it a valuable tool for drug discovery and development.

5. Recombinant Protein Production

Recombinant Human CDCA7 Protein itself is also being produced for various applications, such as in vitro studies and diagnostic assays. Its production through genetic engineering techniques allows for large-scale and consistent production, making it a cost-effective and reliable source of the protein.

Conclusion

In conclusion, Recombinant Human CDCA7 Protein is a highly conserved protein that plays a crucial role in cell cycle regulation and cell proliferation. Its structure, activity, and applications make it a valuable tool for various scientific and medical purposes. As research on this protein continues, it

Recombinant Human CDCA7 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CDCA7 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products