Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human EIF4E3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8N5X7
Molecular weight:
21.04 kDa

Original price was: $276.00.Current price is: $230.00.

50ug 17% OFF + 230 loyalty points
Ser51–His215
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human EIF4E3 Protein, N-His

Product name ARO-P12688-100
Uniprot ID Q8N5X7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SSWTFWLDRSLPGATAAECASNLKKIYTVQTVQIFWSVYNNIPPVTSLPLRCSYHLMRGERRPLWEEESNAKGGVWKMKVPKDSTSTVWKELLLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHH
Molecular weight 21.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser51-His215
Aliases /Synonyms eIF4E-3, Eukaryotic translation initiation factor 4E type 3, eIF-4E type 3, eIF-4E3, EIF4E3, eIF4E type 3
Reference ARO-P12688
Note For research use only.
Molecular Constructor
Ser51–His215
Product name ARO-P12688-1MG
Uniprot ID Q8N5X7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SSWTFWLDRSLPGATAAECASNLKKIYTVQTVQIFWSVYNNIPPVTSLPLRCSYHLMRGERRPLWEEESNAKGGVWKMKVPKDSTSTVWKELLLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHH
Molecular weight 21.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser51-His215
Aliases /Synonyms eIF4E-3, Eukaryotic translation initiation factor 4E type 3, eIF-4E type 3, eIF-4E3, EIF4E3, eIF4E type 3
Reference ARO-P12688
Note For research use only.
Molecular Constructor
Ser51–His215
Product name ARO-P12688-50
Uniprot ID Q8N5X7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SSWTFWLDRSLPGATAAECASNLKKIYTVQTVQIFWSVYNNIPPVTSLPLRCSYHLMRGERRPLWEEESNAKGGVWKMKVPKDSTSTVWKELLLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHH
Molecular weight 21.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser51-His215
Aliases /Synonyms eIF4E-3, Eukaryotic translation initiation factor 4E type 3, eIF-4E type 3, eIF-4E3, EIF4E3, eIF4E type 3
Reference ARO-P12688
Note For research use only.
Molecular Constructor
Ser51–His215

Introduction

Recombinant Human EIF4E3 Protein, also known as eukaryotic translation initiation factor 4E family member 3, is a protein that plays a crucial role in the initiation of protein synthesis. It is encoded by the EIF4E3 gene and belongs to the eIF4E family of proteins. This protein has been extensively studied and has been found to have a diverse range of functions in various cellular processes. In this article, we will discuss the structure, activity, and applications of Recombinant Human EIF4E3 Protein.

Structure of Recombinant Human EIF4E3 Protein

Recombinant Human EIF4E3 Protein is a 25 kDa protein consisting of 223 amino acids. It contains a conserved N-terminal domain, a central eIF4E binding domain, and a C-terminal domain. The N-terminal domain is responsible for binding to the mRNA cap structure, while the eIF4E binding domain interacts with other eIF4E family members. The C-terminal domain is involved in protein-protein interactions and is essential for the regulation of protein synthesis.

Activity of Recombinant Human EIF4E3 Protein

Recombinant Human EIF4E3 Protein is a key component of the eukaryotic translation initiation complex. It plays a crucial role in the initiation of protein synthesis by binding to the 5′ cap structure of mRNA. This binding helps in recruiting other initiation factors and ribosomes to the mRNA, leading to the formation of the translation initiation complex. This complex is responsible for the efficient translation of mRNA into proteins.

Apart from its role in protein synthesis, Recombinant Human EIF4E3 Protein has also been found to have other activities. It has been shown to interact with other proteins involved in cellular processes such as mRNA splicing, RNA transport, and DNA damage response. Additionally, it has been linked to the regulation of cell growth, proliferation, and differentiation.

Applications of Recombinant Human EIF4E3 Protein

Recombinant Human EIF4E3 Protein has a wide range of applications in both basic research and clinical settings. Its role in protein synthesis makes it an essential tool for studying translation initiation and protein synthesis in various biological systems. It has also been used in the development of new drugs targeting protein synthesis, particularly in cancer therapy.

Furthermore, Recombinant Human EIF4E3 Protein has been used as an antigen in the development of diagnostic assays for various diseases. Antibodies against this protein have been shown to be useful in the detection and diagnosis of certain types of cancer, such as breast and ovarian cancer. This highlights the potential of this protein as a biomarker for disease diagnosis and monitoring.

In addition to its applications in research and diagnostics, Recombinant Human EIF4E3 Protein has also been used in the biotechnology industry. It is commonly used as a fusion partner with other proteins to improve their expression and solubility. This has been particularly useful in the production of therapeutic proteins, where the use of Recombinant Human EIF4E3 Protein as a fusion partner has led to increased yields and improved quality of the final product.

Conclusion

Recombinant Human EIF4E3 Protein is a crucial protein involved in the initiation of protein synthesis. Its diverse range of activities makes it an essential component of various cellular processes. Its structure and function have been extensively studied, and its applications in research, diagnostics, and biotechnology have been well established. Further research on this protein may lead to a better understanding of its role in cellular processes and the development of new therapies for diseases.

Recombinant Human EIF4E3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human EIF4E3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products