Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD125/IL5RA Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q01344
Molecular weight:
18.31 kDa

Original price was: $350.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
Gly42–Cys182
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD125/IL5RA Protein, N-His

Product name ARO-P12683-100
Uniprot ID Q01344
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTEEC
Molecular weight 18.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly42-Cys182
Aliases /Synonyms IL-5R subunit alpha, IL-5 receptor subunit alpha, IL5RA, IL-5RA, IL-5R-alpha, Interleukin-5 receptor subunit alpha, CDw125, CD125, IL5R
Reference ARO-P12683
Note For research use only.
Molecular Constructor
Gly42–Cys182
Product name ARO-P12683-1MG
Uniprot ID Q01344
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTEEC
Molecular weight 18.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly42-Cys182
Aliases /Synonyms IL-5R subunit alpha, IL-5 receptor subunit alpha, IL5RA, IL-5RA, IL-5R-alpha, Interleukin-5 receptor subunit alpha, CDw125, CD125, IL5R
Reference ARO-P12683
Note For research use only.
Molecular Constructor
Gly42–Cys182
Product name ARO-P12683-50
Uniprot ID Q01344
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTEEC
Molecular weight 18.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly42-Cys182
Aliases /Synonyms IL-5R subunit alpha, IL-5 receptor subunit alpha, IL5RA, IL-5RA, IL-5R-alpha, Interleukin-5 receptor subunit alpha, CDw125, CD125, IL5R
Reference ARO-P12683
Note For research use only.
Molecular Constructor
Gly42–Cys182

Introduction

Recombinant Human CD125/IL5RA Protein is a type of protein that is produced through genetic engineering techniques. It is also known as Interleukin-5 Receptor Alpha (IL5RA) or CD125. This protein plays a crucial role in the immune system and has been extensively studied for its structure, activity, and potential applications. In this article, we will delve deeper into the various aspects of Recombinant Human CD125/IL5RA Protein.

Structure of Recombinant Human CD125/IL5RA Protein

Recombinant Human CD125/IL5RA Protein is a glycoprotein that is composed of 428 amino acids with a molecular weight of approximately 60 kDa. It is a single-chain transmembrane protein and belongs to the type I cytokine receptor family. The extracellular domain of this protein contains a cytokine receptor homology domain, which is responsible for binding to its ligand, Interleukin-5 (IL-5). The intracellular domain of Recombinant Human CD125/IL5RA Protein has a conserved box 1 motif, which is essential for signal transduction.

Activity of Recombinant Human CD125/IL5RA Protein

Recombinant Human CD125/IL5RA Protein acts as a receptor for IL-5, a cytokine that plays a critical role in the development and function of eosinophils, a type of white blood cell. Upon binding to IL-5, Recombinant Human CD125/IL5RA Protein initiates a signaling cascade that leads to the activation of various pathways involved in cell growth, survival, and differentiation. This protein is primarily expressed on the surface of eosinophils, but it has also been found on other immune cells such as basophils and mast cells.

Applications of Recombinant Human CD125/IL5RA Protein

Recombinant Human CD125/IL5RA Protein has multiple potential applications in the field of immunology and medicine. One of the most significant applications is its role in allergic diseases, as IL-5 is known to be a key mediator in allergic inflammation. Recombinant Human CD125/IL5RA Protein has been studied as a potential therapeutic target for allergic conditions such as asthma, atopic dermatitis, and allergic rhinitis. It has also been investigated as a potential treatment for hypereosinophilic syndromes, a group of rare disorders characterized by high levels of eosinophils in the blood.

In addition to its role in allergic diseases, Recombinant Human CD125/IL5RA Protein has also been studied for its potential in cancer therapy. IL-5 has been found to play a role in the growth and survival of certain types of cancer cells, and targeting Recombinant Human CD125/IL5RA Protein has been proposed as a strategy to inhibit this effect. Furthermore, Recombinant Human CD125/IL5RA Protein has been investigated as a potential biomarker for certain types of cancer, as its expression has been found to be elevated in some cancer cells.

Recombinant Human CD125/IL5RA Protein has also been studied in the development of novel vaccines. IL-5 is known to play a role in the immune response against parasitic infections, and Recombinant Human CD125/IL5RA Protein has been used as a target for vaccine development against parasitic diseases such as schistosomiasis and leishmaniasis.

Conclusion

In summary, Recombinant Human CD125/IL5RA Protein is a crucial protein involved in the immune system and has multiple potential applications in the fields of allergy, cancer therapy, and vaccine development. Its structure and activity have been extensively studied, and ongoing research continues to uncover new insights into its role in various diseases. With its diverse range of applications, Recombinant Human CD125/IL5RA Protein holds great promise for the future of medicine.

Recombinant Human CD125/IL5RA Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CD125/IL5RA Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products