Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TOP2B Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q02880
Molecular weight:
35.24 kDa

Original price was: $422.00.Current price is: $327.00.

100ug 23% OFF + 327 loyalty points
Ser50–Asn336
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TOP2B Protein, N-His

Product name ARO-P11163-100
Uniprot ID Q02880
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVERVYQKKTQLEHILLRPDTYIGSVEPLTQFMWVYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLSEKGFQQISFVN
Molecular weight 35.24 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser50-Asn336
Aliases /Synonyms DNA topoisomerase 2-beta, TOP2B, DNA topoisomerase II, beta isozyme
Reference ARO-P11163
Note For research use only.
Molecular Constructor
Ser50–Asn336
Product name ARO-P11163-1MG
Uniprot ID Q02880
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVERVYQKKTQLEHILLRPDTYIGSVEPLTQFMWVYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLSEKGFQQISFVN
Molecular weight 35.24 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser50-Asn336
Aliases /Synonyms DNA topoisomerase 2-beta, TOP2B, DNA topoisomerase II, beta isozyme
Reference ARO-P11163
Note For research use only.
Molecular Constructor
Ser50–Asn336
Product name ARO-P11163-50
Uniprot ID Q02880
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVERVYQKKTQLEHILLRPDTYIGSVEPLTQFMWVYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLSEKGFQQISFVN
Molecular weight 35.24 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser50-Asn336
Aliases /Synonyms DNA topoisomerase 2-beta, TOP2B, DNA topoisomerase II, beta isozyme
Reference ARO-P11163
Note For research use only.
Molecular Constructor
Ser50–Asn336

Title: Introduction to Recombinant Human TOP2B Protein

Recombinant Human TOP2B protein, also known as topoisomerase II beta, is a key enzyme involved in DNA replication and repair. This protein is encoded by the TOP2B gene and is expressed in many tissues and cell types. Recombinant Human TOP2B protein is a valuable tool in the field of molecular biology and has various applications in research and medicine.

Title: Structure of Recombinant Human TOP2B Protein

Recombinant Human TOP2B protein is a 174 kDa protein composed of 1526 amino acids. It is a homodimer, with each monomer consisting of four domains: the N-terminal domain, the central DNA-binding domain, the ATPase domain, and the C-terminal domain. The N-terminal domain is responsible for DNA binding, while the central domain contains the active site for DNA cleavage and ligation. The ATPase domain is involved in the energy-dependent catalytic activity of the protein, and the C-terminal domain is involved in protein-protein interactions.

Title: Activity of Recombinant Human TOP2B Protein

Recombinant Human TOP2B protein is a type II topoisomerase, which means it is involved in the breaking and rejoining of double-stranded DNA. This activity is essential for DNA replication, transcription, and repair. The protein works by creating a transient double-strand break in the DNA, allowing it to pass another strand through the break before rejoining the DNA. This process helps to relieve the tension and supercoiling of DNA, which is crucial for proper DNA functioning.

Title: Applications of Recombinant Human TOP2B Protein

1. Drug Discovery: Recombinant Human TOP2B protein is a target for many anti-cancer drugs, as it is essential for cell proliferation and survival. The protein is also involved in the resistance of cancer cells to chemotherapy, making it a valuable target for drug development.

2. DNA Research: Recombinant Human TOP2B protein is used in various DNA research techniques, such as DNA sequencing, gene expression analysis, and DNA-protein interaction studies. Its ability to create and resolve DNA breaks makes it a valuable tool in these studies.

3. Antigen for Antibody Production: Recombinant Human TOP2B protein can be used as an antigen to produce antibodies. These antibodies can then be used in various immunoassays to detect and quantify the protein in biological samples.

4. Biomarker for Disease Diagnosis: Abnormal expression of TOP2B has been linked to various diseases, including cancer and Alzheimer’s disease. Recombinant Human TOP2B protein can be used as a biomarker for these diseases, aiding in their diagnosis and monitoring.

5. Gene Therapy: Recombinant Human TOP2B protein has been used in gene therapy to deliver therapeutic genes into cells. The protein’s ability to create transient DNA breaks allows for the insertion of foreign DNA into the genome, making it a valuable tool in gene therapy.

Title: Conclusion

Recombinant Human TOP2B protein is a crucial enzyme involved in DNA replication and repair. Its structure, activity, and various applications make it a valuable tool in the field of molecular biology. From drug discovery to gene therapy, this protein has a wide range of applications and continues to be a topic of interest for researchers. Its use in various techniques and studies has greatly advanced our understanding of DNA and its role in health and disease.

Recombinant Human TOP2B Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TOP2B Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products