Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SIAH2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O43255
Molecular weight:
30.91 kDa

Original price was: $296.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Ser68–Pro324
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SIAH2 Protein, N-His

Product name ARO-P10816-100
Uniprot ID O43255
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP
Molecular weight 30.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser68-Pro324
Aliases /Synonyms RING-type E3 ubiquitin transferase SIAH2, SIAH2, hSiah2, Seven in absentia homolog 2, Siah-2, E3 ubiquitin-protein ligase SIAH2
Reference ARO-P10816
Note For research use only.
Molecular Constructor
Ser68–Pro324
Product name ARO-P10816-1MG
Uniprot ID O43255
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP
Molecular weight 30.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser68-Pro324
Aliases /Synonyms RING-type E3 ubiquitin transferase SIAH2, SIAH2, hSiah2, Seven in absentia homolog 2, Siah-2, E3 ubiquitin-protein ligase SIAH2
Reference ARO-P10816
Note For research use only.
Molecular Constructor
Ser68–Pro324
Product name ARO-P10816-50
Uniprot ID O43255
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP
Molecular weight 30.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser68-Pro324
Aliases /Synonyms RING-type E3 ubiquitin transferase SIAH2, SIAH2, hSiah2, Seven in absentia homolog 2, Siah-2, E3 ubiquitin-protein ligase SIAH2
Reference ARO-P10816
Note For research use only.
Molecular Constructor
Ser68–Pro324

Introduction

Recombinant Human SIAH2 Protein is a highly versatile protein that has gained significant attention in the field of biomedical research. It is a recombinant protein, meaning it is produced through genetic engineering techniques, and is a crucial player in various cellular processes. In this article, we will explore the structure, activity, and application of this protein in detail.

Structure of Recombinant Human SIAH2 Protein

The SIAH2 gene encodes for the SIAH2 protein, which is a member of the E3 ubiquitin-protein ligase family. This protein is composed of 323 amino acids and has a molecular weight of approximately 39 kDa. It consists of three main domains: an N-terminal RING finger domain, a central SIAH domain, and a C-terminal substrate-binding domain.

The RING finger domain is responsible for the E3 ubiquitin ligase activity of SIAH2, while the SIAH domain is essential for its interaction with other proteins. The substrate-binding domain contains a conserved substrate-binding motif, which is responsible for binding to specific target proteins for ubiquitination and subsequent degradation.

Activity of Recombinant Human SIAH2 Protein

SIAH2 is a critical regulator of various cellular processes, including cell proliferation, differentiation, and apoptosis. Its main function is to target specific proteins for degradation by the ubiquitin-proteasome system. This process involves the attachment of ubiquitin molecules to the target protein, marking it for destruction by the proteasome.

Studies have shown that SIAH2 plays a crucial role in the regulation of the hypoxia response pathway. It targets hypoxia-inducible factor 1-alpha (HIF-1α) for degradation, thereby preventing the activation of genes involved in promoting cell survival under low oxygen conditions. Additionally, SIAH2 has been found to regulate the levels of several tumor suppressor proteins, such as p53 and PTEN, making it a potential target for cancer therapy.

Application of Recombinant Human SIAH2 Protein

Due to its diverse functions, SIAH2 has become a subject of interest in various fields of research. One of the major applications of recombinant SIAH2 protein is in drug discovery and development. As mentioned earlier, SIAH2 has been implicated in cancer progression, making it a potential target for anti-cancer drugs. Researchers are currently investigating the use of SIAH2 inhibitors as a novel approach for cancer treatment.

Another potential application of SIAH2 protein is in the field of regenerative medicine. Studies have shown that SIAH2 plays a critical role in the differentiation of stem cells into various cell types. This finding opens up the possibility of using SIAH2 protein to control and direct stem cell differentiation, which can have significant implications in tissue engineering and regenerative medicine.

Furthermore, SIAH2 has been linked to several neurodegenerative diseases, such as Alzheimer’s and Parkinson’s disease. It has been found to regulate the levels of proteins involved in these diseases, making it a potential therapeutic target.

Conclusion

In summary, Recombinant Human SIAH2 Protein is a highly versatile protein with a crucial role in various cellular processes. Its structure, activity, and application have been extensively studied, and it has shown great potential in the fields of drug discovery, regenerative medicine, and neurodegenerative diseases. Further research on this protein is essential for a better understanding of its functions and potential therapeutic applications.

Recombinant Human SIAH2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SIAH2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products