Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human EHBP1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8NDI1
Molecular weight:
14.55 kDa

Original price was: $255.00.Current price is: $230.00.

50ug 10% OFF + 230 loyalty points
Met1–Asn104
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human EHBP1 Protein, N-His

Product name ARO-P12066-100
Uniprot ID Q8NDI1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHAEEFEDKEWTFVIEN
Molecular weight 14.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn104
Aliases /Synonyms EH domain-binding protein 1, KIAA0903, NACSIN, EHBP1
Reference ARO-P12066
Note For research use only.
Molecular Constructor
Met1–Asn104
Product name ARO-P12066-1MG
Uniprot ID Q8NDI1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHAEEFEDKEWTFVIEN
Molecular weight 14.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn104
Aliases /Synonyms EH domain-binding protein 1, KIAA0903, NACSIN, EHBP1
Reference ARO-P12066
Note For research use only.
Molecular Constructor
Met1–Asn104
Product name ARO-P12066-50
Uniprot ID Q8NDI1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHAEEFEDKEWTFVIEN
Molecular weight 14.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn104
Aliases /Synonyms EH domain-binding protein 1, KIAA0903, NACSIN, EHBP1
Reference ARO-P12066
Note For research use only.
Molecular Constructor
Met1–Asn104

Introduction

Recombinant Human EHBP1 Protein is a highly purified and bioactive protein that has been produced through recombinant DNA technology. This protein plays a crucial role in various cellular processes and has been widely studied for its potential applications in research and medicine. In this article, we will discuss the structure, activity, and applications of Recombinant Human EHBP1 Protein.

Structure of Recombinant Human EHBP1 Protein

Recombinant Human EHBP1 Protein is a 130 kDa protein that is composed of 1154 amino acids. It belongs to the EHBP family of proteins, which are known to be involved in endocytosis and membrane trafficking. The protein has a conserved N-terminal EH domain, which is responsible for its binding to other proteins and lipids. It also contains a central coiled-coil domain and a C-terminal proline-rich region. The EHBP1 protein is highly conserved among different species, indicating its importance in cellular function.

Activity of Recombinant Human EHBP1 Protein

The main activity of Recombinant Human EHBP1 Protein is its involvement in endocytosis, which is the process of internalizing substances into the cell. This protein binds to phosphatidylinositol-4,5-bisphosphate (PIP2) on the cell membrane and recruits other proteins, such as the clathrin adaptor AP2, to form clathrin-coated pits. These pits then invaginate and pinch off to form vesicles containing the internalized substances. EHBP1 also plays a role in the recycling of endocytic vesicles back to the cell surface, thus regulating the levels of cell surface receptors.

Apart from endocytosis, Recombinant Human EHBP1 Protein has been shown to be involved in other cellular processes, such as cytokinesis, cell migration, and cell adhesion. It has also been reported to interact with other proteins, including Rho GTPases and the cytoskeletal protein actin, suggesting its role in regulating cytoskeletal dynamics.

Applications of Recombinant Human EHBP1 Protein

Given its crucial role in cellular processes, Recombinant Human EHBP1 Protein has been studied extensively for its potential applications in research and medicine. Some of the key applications include:

1. Study of Endocytosis

Recombinant Human EHBP1 Protein has been widely used as a tool to study endocytosis. Its ability to bind to PIP2 and recruit other proteins involved in endocytosis makes it an important component in understanding the molecular mechanisms of this process. Researchers have used this protein to study the dynamics of endocytic vesicles and the regulation of cell surface receptors.

2. Drug Target Identification

EHBP1 has been identified as a potential drug target for diseases such as cancer and viral infections. Inhibition of EHBP1 has been shown to affect endocytosis and cell migration, making it a promising target for anti-cancer and anti-viral therapies. Recombinant Human EHBP1 Protein can be used in drug screening assays to identify potential inhibitors of this protein.

3. Biomarker for Disease Diagnosis

EHBP1 has been found to be overexpressed in certain types of cancer, such as breast and ovarian cancer. This makes it a potential biomarker for these diseases, as well as a potential target for cancer therapy. Recombinant Human EHBP1 Protein can be used in diagnostic tests to detect elevated levels of this protein in patient samples.

4. Production of Antibodies

Recombinant Human EHBP1 Protein has also been used to produce antibodies that can specifically recognize this protein. These antibodies can be used in various research applications, such as Western blotting, immunofluorescence, and immunoprecipitation, to study the expression and localization of EHBP1 in different cell types and tissues.

5. Therapeutic Protein

Recombinant Human EHBP1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human EHBP1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products