Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human EIF2D Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P41214
Molecular weight:
17.25 kDa

Original price was: $282.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Lys45–Lys182
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human EIF2D Protein, N-His

Product name ARO-P12341-100
Uniprot ID P41214
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KEELNIVKLYAHKGDAVTVYVSGGNPILFELEKNLYPTVYTLWSYPDLLPTFTTWPLVLEKLVGGADLMLPGLVMPPAGLPQVQKGDLCAISLVGNRAPVAIGVAAMSTAEMLTSGLKGRGFSVLHTYQDHLWRSGNK
Molecular weight 17.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys45-Lys182
Aliases /Synonyms LGTN, Ligatin, HCA56, Hepatocellular carcinoma-associated antigen 56, Eukaryotic translation initiation factor 2D, eIF2d, EIF2D
Reference ARO-P12341
Note For research use only.
Molecular Constructor
Lys45–Lys182
Product name ARO-P12341-1MG
Uniprot ID P41214
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KEELNIVKLYAHKGDAVTVYVSGGNPILFELEKNLYPTVYTLWSYPDLLPTFTTWPLVLEKLVGGADLMLPGLVMPPAGLPQVQKGDLCAISLVGNRAPVAIGVAAMSTAEMLTSGLKGRGFSVLHTYQDHLWRSGNK
Molecular weight 17.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys45-Lys182
Aliases /Synonyms LGTN, Ligatin, HCA56, Hepatocellular carcinoma-associated antigen 56, Eukaryotic translation initiation factor 2D, eIF2d, EIF2D
Reference ARO-P12341
Note For research use only.
Molecular Constructor
Lys45–Lys182
Product name ARO-P12341-50
Uniprot ID P41214
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KEELNIVKLYAHKGDAVTVYVSGGNPILFELEKNLYPTVYTLWSYPDLLPTFTTWPLVLEKLVGGADLMLPGLVMPPAGLPQVQKGDLCAISLVGNRAPVAIGVAAMSTAEMLTSGLKGRGFSVLHTYQDHLWRSGNK
Molecular weight 17.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys45-Lys182
Aliases /Synonyms LGTN, Ligatin, HCA56, Hepatocellular carcinoma-associated antigen 56, Eukaryotic translation initiation factor 2D, eIF2d, EIF2D
Reference ARO-P12341
Note For research use only.
Molecular Constructor
Lys45–Lys182

Introduction to Recombinant Human EIF2D Protein

Recombinant Human EIF2D Protein, also known as eukaryotic initiation factor 2D, is a protein that plays a crucial role in protein synthesis in eukaryotic cells. This protein is encoded by the EIF2D gene and is a member of the eIF2 family of proteins. Recombinant Human EIF2D Protein is produced through recombinant DNA technology, making it a valuable tool for researchers in various fields of biology and medicine.

Structure of Recombinant Human EIF2D Protein

Recombinant Human EIF2D Protein is a 17 kDa protein consisting of 153 amino acids. It contains a conserved N-terminal domain and a C-terminal domain that is highly variable among different species. The N-terminal domain of Recombinant Human EIF2D Protein is responsible for its interaction with other eIF2 family members, while the C-terminal domain is involved in its binding to the 40S ribosomal subunit.

Activity of Recombinant Human EIF2D Protein

Recombinant Human EIF2D Protein is an essential factor in the initiation of protein synthesis in eukaryotic cells. It acts as a guanine nucleotide exchange factor, which means it facilitates the exchange of GDP for GTP on the eukaryotic initiation factor 2 (eIF2). This exchange is necessary for the formation of the pre-initiation complex, which is the first step in protein synthesis. Recombinant Human EIF2D Protein also plays a role in regulating the activity of eIF2, which is involved in the control of global protein synthesis in response to cellular stress.

Application of Recombinant Human EIF2D Protein

Recombinant Human EIF2D Protein has a wide range of applications in both basic research and clinical settings. Here are some of its key applications:

1. Studying protein synthesis

Recombinant Human EIF2D Protein is a valuable tool for studying the process of protein synthesis in eukaryotic cells. Its role in the formation of the pre-initiation complex and regulation of eIF2 activity makes it an important protein for understanding the mechanisms of protein synthesis.

2. Drug discovery

As Recombinant Human EIF2D Protein is involved in regulating protein synthesis, it has been identified as a potential target for drug development. Inhibitors of this protein could be used to modulate protein synthesis in various diseases, such as cancer and viral infections.

3. Diagnostic tool

Recombinant Human EIF2D Protein can be used as an antigen in diagnostic tests for certain diseases. Antibodies against this protein have been found in patients with autoimmune diseases, making it a potential biomarker for these conditions.

4. Therapeutic agent

Recombinant Human EIF2D Protein has been studied as a potential therapeutic agent for certain diseases. For example, it has been shown to have anti-inflammatory effects in animal models, making it a potential treatment for inflammatory diseases.

5. Vaccine development

Recombinant Human EIF2D Protein has also been used in vaccine development. It has been shown to elicit an immune response in animal studies, making it a potential antigen for the development of vaccines against certain diseases.

Conclusion

Recombinant Human EIF2D Protein is a crucial protein involved in the initiation of protein synthesis in eukaryotic cells. Its structure, activity, and various applications make it a valuable tool for researchers in different fields. As our understanding of this protein continues to grow, it is likely to have even more significant applications in the future.

Recombinant Human EIF2D Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human EIF2D Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products