Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human FBXW7 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q969H0
Molecular weight:
29.46 kDa

Original price was: $303.00.Current price is: $271.00.

50ug 11% OFF + 271 loyalty points
His Asp279–Val515
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human FBXW7 Protein, N-His

Recombinant Human FBXW7 Protein, N-His

Product name ARO-P15513-100
Uniprot ID Q969H0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVV
Molecular weight 29.46 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp279-Val515
Aliases /Synonyms SEL10, F-box and WD-40 domain-containing protein 7, F-box protein FBX30, FBW7, Archipelago homolog, hCdc4, SEL-10, hAgo, F-box/WD repeat-containing protein 7, FBX30, FBXW7
Reference ARO-P15513
Note For research use only.
Molecular Constructor
His Asp279–Val515
Product name ARO-P15513-1MG
Uniprot ID Q969H0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVV
Molecular weight 29.46 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp279-Val515
Aliases /Synonyms SEL10, F-box and WD-40 domain-containing protein 7, F-box protein FBX30, FBW7, Archipelago homolog, hCdc4, SEL-10, hAgo, F-box/WD repeat-containing protein 7, FBX30, FBXW7
Reference ARO-P15513
Note For research use only.
Molecular Constructor
His Asp279–Val515
Product name ARO-P15513-50
Uniprot ID Q969H0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVV
Molecular weight 29.46 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp279-Val515
Aliases /Synonyms SEL10, F-box and WD-40 domain-containing protein 7, F-box protein FBX30, FBW7, Archipelago homolog, hCdc4, SEL-10, hAgo, F-box/WD repeat-containing protein 7, FBX30, FBXW7
Reference ARO-P15513
Note For research use only.
Molecular Constructor
His Asp279–Val515

There are no reviews yet.

Be the first to review “Recombinant Human FBXW7 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products