Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FGF20, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NP95
Molecular weight:
25.81 kDa

Original price was: $458.00.Current price is: $392.00.

100ug 14% OFF + 392 loyalty points
Met1–Thr211
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FGF20, N-His

Product name ARO-P13081-100
Uniprot ID Q9NP95
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT
Molecular weight 25.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr211
Aliases /Synonyms FGF-20, FGF20, Fibroblast growth factor 20
Reference ARO-P13081
Note For research use only.
Molecular Constructor
Met1–Thr211
Product name ARO-P13081-1MG
Uniprot ID Q9NP95
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT
Molecular weight 25.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr211
Aliases /Synonyms FGF-20, FGF20, Fibroblast growth factor 20
Reference ARO-P13081
Note For research use only.
Molecular Constructor
Met1–Thr211
Product name ARO-P13081-50
Uniprot ID Q9NP95
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT
Molecular weight 25.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr211
Aliases /Synonyms FGF-20, FGF20, Fibroblast growth factor 20
Reference ARO-P13081
Note For research use only.
Molecular Constructor
Met1–Thr211

Introduction to Recombinant Human FGF20

Recombinant Human FGF20 (rhFGF20) is a protein that is produced through genetic engineering techniques using the DNA sequence of the human FGF20 gene. This protein belongs to the fibroblast growth factor (FGF) family and plays a crucial role in various cellular processes such as cell growth, differentiation, and survival. In this article, we will discuss the structure, activity, and applications of rhFGF20.

Structure of rhFGF20

rhFGF20 is a small protein consisting of 211 amino acids with a molecular weight of approximately 23 kDa. It contains a conserved core region of 120 amino acids, known as the FGF domain, which is responsible for the binding of FGF receptors (FGFRs). This domain is surrounded by N- and C-terminal extensions that contribute to the stability and specificity of the protein. rhFGF20 also contains a signal peptide at the N-terminus, which is responsible for its secretion from the cell.

Similar to other FGFs, rhFGF20 also requires heparan sulfate proteoglycans (HSPGs) for its binding to FGFRs. The binding of rhFGF20 to FGFRs results in the activation of downstream signaling pathways, including the mitogen-activated protein kinase (MAPK) and phosphatidylinositol 3-kinase (PI3K) pathways, which regulate cell proliferation, differentiation, and survival.

Activity of rhFGF20

rhFGF20 has been shown to have a wide range of activities in various cell types and tissues. It is primarily expressed in the brain, with high levels found in the substantia nigra and cerebellum. Studies have shown that rhFGF20 promotes the survival and differentiation of dopaminergic neurons, which are the cells responsible for producing dopamine, a neurotransmitter that is essential for motor function. This suggests that rhFGF20 may have potential therapeutic applications in neurodegenerative diseases such as Parkinson’s disease.

Furthermore, rhFGF20 has been found to play a role in bone development and repair. It has been shown to stimulate the proliferation and differentiation of osteoblasts, the cells responsible for bone formation. This suggests that rhFGF20 may have potential applications in bone regeneration and treatment of bone disorders.

In addition, rhFGF20 has been found to have angiogenic properties, promoting the growth of blood vessels. This is important in wound healing and tissue repair, as well as in diseases such as coronary artery disease and peripheral artery disease. Studies have also shown that rhFGF20 can protect against heart damage and improve cardiac function in animal models of heart disease.

Applications of rhFGF20

The unique properties and activities of rhFGF20 make it a promising candidate for various therapeutic applications. One of the main applications of rhFGF20 is in the treatment of neurodegenerative diseases, particularly Parkinson’s disease. Clinical trials are currently underway to evaluate the safety and efficacy of rhFGF20 in patients with Parkinson’s disease.

Another potential application of rhFGF20 is in bone regeneration and treatment of bone disorders. Preclinical studies have shown promising results in promoting bone formation and repair, and further research is needed to evaluate its potential in clinical settings.

In addition, the angiogenic properties of rhFGF20 make it a potential candidate for the treatment of cardiovascular diseases. Clinical trials have shown that rhFGF20 can improve cardiac function and reduce heart damage in patients with heart disease. Further research is needed to fully understand the potential of rhFGF20 in this field.

Conclusion

In summary, rhFGF20 is a promising recombinant protein with a wide range of activities and potential therapeutic applications. Its unique structure and ability to activate multiple signaling pathways make it

Recombinant Human FGF20, N-His

There are no reviews yet.

Be the first to review “Recombinant Human FGF20, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products