Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FGF23 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9GZV9
Molecular weight:
27.63 kDa

Original price was: $303.00.Current price is: $274.00.

50ug 10% OFF + 274 loyalty points
Tyr25–Ile251
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FGF23 Protein, N-His

Product name ARO-P12726-100
Uniprot ID Q9GZV9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI
Molecular weight 27.63 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr25-Ile251
Aliases /Synonyms Phosphatonin, FGF-23, HYPF, FGF23, Fibroblast growth factor 23, Tumor-derived hypophosphatemia-inducing factor
Reference ARO-P12726
Note For research use only.
Molecular Constructor
Tyr25–Ile251
Product name ARO-P12726-1MG
Uniprot ID Q9GZV9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI
Molecular weight 27.63 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr25-Ile251
Aliases /Synonyms Phosphatonin, FGF-23, HYPF, FGF23, Fibroblast growth factor 23, Tumor-derived hypophosphatemia-inducing factor
Reference ARO-P12726
Note For research use only.
Molecular Constructor
Tyr25–Ile251
Product name ARO-P12726-50
Uniprot ID Q9GZV9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI
Molecular weight 27.63 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr25-Ile251
Aliases /Synonyms Phosphatonin, FGF-23, HYPF, FGF23, Fibroblast growth factor 23, Tumor-derived hypophosphatemia-inducing factor
Reference ARO-P12726
Note For research use only.
Molecular Constructor
Tyr25–Ile251

Recombinant Human FGF23 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human FGF23 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products