Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human FKBP1B, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P68106
Molecular weight:
13.96 kDa

Original price was: $289.00.Current price is: $230.00.

50ug 20% OFF + 230 loyalty points
His Gly2–Glu108
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human FKBP1B, N-His

Recombinant Human FKBP1B, N-His

Product name ARO-P13565-100
Uniprot ID P68106
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Molecular weight 13.96 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly2-Glu108
Aliases /Synonyms Immunophilin FKBP12.6, FKBP-12.6, FKBP1B, FKBP9, FKBP-1B, h-FKBP-12, 12.6 kDa FKBP, FK506-binding protein 1B, FKBP1L, Rotamase, FKBP12.6, OTK4, 12.6 kDa FK506-binding protein, Peptidyl-prolyl cis-trans isomerase FKBP1B, PPIase FKBP1B
Reference ARO-P13565
Note For research use only.
Molecular Constructor
His Gly2–Glu108
Product name ARO-P13565-1MG
Uniprot ID P68106
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Molecular weight 13.96 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly2-Glu108
Aliases /Synonyms Immunophilin FKBP12.6, FKBP-12.6, FKBP1B, FKBP9, FKBP-1B, h-FKBP-12, 12.6 kDa FKBP, FK506-binding protein 1B, FKBP1L, Rotamase, FKBP12.6, OTK4, 12.6 kDa FK506-binding protein, Peptidyl-prolyl cis-trans isomerase FKBP1B, PPIase FKBP1B
Reference ARO-P13565
Note For research use only.
Molecular Constructor
His Gly2–Glu108
Product name ARO-P13565-50
Uniprot ID P68106
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Molecular weight 13.96 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly2-Glu108
Aliases /Synonyms Immunophilin FKBP12.6, FKBP-12.6, FKBP1B, FKBP9, FKBP-1B, h-FKBP-12, 12.6 kDa FKBP, FK506-binding protein 1B, FKBP1L, Rotamase, FKBP12.6, OTK4, 12.6 kDa FK506-binding protein, Peptidyl-prolyl cis-trans isomerase FKBP1B, PPIase FKBP1B
Reference ARO-P13565
Note For research use only.
Molecular Constructor
His Gly2–Glu108

Recombinant Human FKBP1B, N-His

There are no reviews yet.

Be the first to review “Recombinant Human FKBP1B, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products