Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human FKBP5 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q13451
Molecular weight:
28.87 kDa

Original price was: $257.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Ser13–Lys252
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human FKBP5 Protein, N-His

Recombinant Human FKBP5 Protein, N-His

Product name ARO-P11263-100
Uniprot ID Q13451
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEK
Molecular weight 28.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser13-Lys252
Aliases /Synonyms AIG6, 51 kDa FKBP, FKBP51, FKBP54, Rotamase, Peptidyl-prolyl cis-trans isomerase FKBP5, FF1 antigen, 51 kDa FK506-binding protein, FKBP-51, Androgen-regulated protein 6, p54, PPIase FKBP5, 54 kDa progesterone receptor-associated immunophilin, HSP90-binding immunophilin, FKBP-5, FK506-binding protein 5, FKBP5
Reference ARO-P11263
Note For research use only.
Molecular Constructor
Ser13–Lys252
Product name ARO-P11263-1MG
Uniprot ID Q13451
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEK
Molecular weight 28.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser13-Lys252
Aliases /Synonyms AIG6, 51 kDa FKBP, FKBP51, FKBP54, Rotamase, Peptidyl-prolyl cis-trans isomerase FKBP5, FF1 antigen, 51 kDa FK506-binding protein, FKBP-51, Androgen-regulated protein 6, p54, PPIase FKBP5, 54 kDa progesterone receptor-associated immunophilin, HSP90-binding immunophilin, FKBP-5, FK506-binding protein 5, FKBP5
Reference ARO-P11263
Note For research use only.
Molecular Constructor
Ser13–Lys252
Product name ARO-P11263-50
Uniprot ID Q13451
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEK
Molecular weight 28.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser13-Lys252
Aliases /Synonyms AIG6, 51 kDa FKBP, FKBP51, FKBP54, Rotamase, Peptidyl-prolyl cis-trans isomerase FKBP5, FF1 antigen, 51 kDa FK506-binding protein, FKBP-51, Androgen-regulated protein 6, p54, PPIase FKBP5, 54 kDa progesterone receptor-associated immunophilin, HSP90-binding immunophilin, FKBP-5, FK506-binding protein 5, FKBP5
Reference ARO-P11263
Note For research use only.
Molecular Constructor
Ser13–Lys252

Recombinant Human FKBP5 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human FKBP5 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products