Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human Flt3 ligand/FLT3LG Protein, N-His

Host species:
Insect cells
Origin species:
Human
Uniprot ID:
P49771
Molecular weight:
19.17 kDa

Original price was: $566.00.Current price is: $446.00.

100ug 21% OFF + 446 loyalty points
Ser25–Pro184
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human Flt3 ligand/FLT3LG Protein, N-His

Product name ARO-P11333-100
Uniprot ID P49771
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence SGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQP
Molecular weight 19.17 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect cells
Fragment Type Ser25-Pro184
Aliases /Synonyms FLT3LG protein, FLT3LG
Reference ARO-P11333
Note For research use only.
Molecular Constructor
Ser25–Pro184
Product name ARO-P11333-1MG
Uniprot ID P49771
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence SGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQP
Molecular weight 19.17 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect cells
Fragment Type Ser25-Pro184
Aliases /Synonyms FLT3LG protein, FLT3LG
Reference ARO-P11333
Note For research use only.
Molecular Constructor
Ser25–Pro184
Product name ARO-P11333-50
Uniprot ID P49771
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence SGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQP
Molecular weight 19.17 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect cells
Fragment Type Ser25-Pro184
Aliases /Synonyms FLT3LG protein, FLT3LG
Reference ARO-P11333
Note For research use only.
Molecular Constructor
Ser25–Pro184

Recombinant Human Flt3 ligand/FLT3LG Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human Flt3 ligand/FLT3LG Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products