Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human LTB/TNFC Protein, C-His

Host species:
Insect cells
Origin species:
Human
Uniprot ID:
Q06643
Molecular weight:
21.90 kDa

Original price was: $344.00.Current price is: $313.00.

50ug 9% OFF + 313 loyalty points
Gly86–Gly244
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human LTB/TNFC Protein, C-His

Product name ARO-P11331-100
Uniprot ID Q06643
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRAPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG
Molecular weight 21.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect cells
Fragment Type Gly86-Gly244
Aliases /Synonyms Lymphotoxin-beta, LT-beta, Tumor necrosis factor C, TNF-C, Tumor necrosis factor ligand superfamily member 3, LTB, TNFC, TNFSF3
Reference ARO-P11331
Note For research use only.
Molecular Constructor
Gly86–Gly244
Product name ARO-P11331-1MG
Uniprot ID Q06643
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRAPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG
Molecular weight 21.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect cells
Fragment Type Gly86-Gly244
Aliases /Synonyms Lymphotoxin-beta, LT-beta, Tumor necrosis factor C, TNF-C, Tumor necrosis factor ligand superfamily member 3, LTB, TNFC, TNFSF3
Reference ARO-P11331
Note For research use only.
Molecular Constructor
Gly86–Gly244
Product name ARO-P11331-50
Uniprot ID Q06643
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRAPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG
Molecular weight 21.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect cells
Fragment Type Gly86-Gly244
Aliases /Synonyms Lymphotoxin-beta, LT-beta, Tumor necrosis factor C, TNF-C, Tumor necrosis factor ligand superfamily member 3, LTB, TNFC, TNFSF3
Reference ARO-P11331
Note For research use only.
Molecular Constructor
Gly86–Gly244

Introduction

Recombinant Human LTB/TNFC Protein, also known as Lymphotoxin Beta (LTB) or Tumor Necrosis Factor C (TNFC), is a protein that plays a crucial role in the immune system. It is a member of the tumor necrosis factor (TNF) superfamily and is involved in various immune responses, including inflammation and cell death. In this article, we will discuss the structure, activity, and applications of Recombinant Human LTB/TNFC Protein.

Structure of Recombinant Human LTB/TNFC Protein

Recombinant Human LTB/TNFC Protein is a homotrimeric protein, meaning it is composed of three identical subunits. Each subunit has a molecular weight of approximately 18 kDa and is composed of 171 amino acids. The structure of LTB/TNFC is similar to other members of the TNF superfamily, with a central beta-sheet surrounded by alpha-helices.

Activity of Recombinant Human LTB/TNFC Protein

Recombinant Human LTB/TNFC Protein is a potent cytokine that plays a crucial role in the immune system. It is primarily produced by activated T cells and natural killer cells and acts on a variety of cell types, including immune cells, endothelial cells, and epithelial cells. LTB/TNFC binds to its receptor, TNFRSF3/LTBR, and activates various signaling pathways, leading to the activation of immune responses.

One of the main activities of LTB/TNFC is its role in inflammation. It can induce the production of other cytokines, such as interleukin-6 and chemokines, which recruit immune cells to the site of inflammation. LTB/TNFC also promotes the proliferation and activation of T cells and B cells, which are essential for mounting an effective immune response against pathogens.

Another important activity of LTB/TNFC is its role in cell death. It can induce apoptosis, or programmed cell death, in certain cell types, such as cancer cells. This makes LTB/TNFC a potential therapeutic target for cancer treatment.

Applications of Recombinant Human LTB/TNFC Protein

Recombinant Human LTB/TNFC Protein has various applications in both research and clinical settings. In research, it is commonly used as a tool to study the immune system and inflammation. LTB/TNFC can be added to cell cultures to induce immune responses, and its effects can be studied to understand its role in various diseases.

In the clinic, LTB/TNFC has been investigated as a potential therapeutic target for various diseases. Its role in inflammation makes it a potential target for treating autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis. It has also been studied for its potential in cancer treatment, as it can induce apoptosis in cancer cells.

One of the most significant applications of Recombinant Human LTB/TNFC Protein is its use as a vaccine adjuvant. Adjuvants are substances that are added to vaccines to enhance the immune response. LTB/TNFC has been shown to enhance the immune response to vaccines, making it a promising adjuvant for developing more effective vaccines against infectious diseases.

Conclusion

Recombinant Human LTB/TNFC Protein is a potent cytokine that plays a crucial role in the immune system. Its structure, activity, and various applications make it a valuable tool for studying the immune system and a potential therapeutic target for various diseases. With ongoing research, we can continue to uncover the potential of LTB/TNFC and its applications in medicine.

Recombinant Human LTB/TNFC Protein, C-His

There are no reviews yet.

Be the first to review “Recombinant Human LTB/TNFC Protein, C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products