Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DBT/BCOADC-E2 Protein, C-Strep

Host species:
Insect cells
Origin species:
Human
Uniprot ID:
P11182
Molecular weight:
47.68 kDa

Original price was: $434.00.Current price is: $350.00.

50ug 19% OFF + 350 loyalty points
Gly62–Lys482 Strep
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DBT/BCOADC-E2 Protein, C-Strep

Product name ARO-P15980-100
Uniprot ID P11182
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATELNRLQKLGSVSQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK
Molecular weight 47.68 kDa
Protein delivered with Tag? C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Insect cells
Fragment Type Gly62-Lys482
Aliases /Synonyms Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial, 2.3.1.168, 52 kDa mitochondrial autoantigen of primary biliary cirrhosis, Branched chain 2-oxo-acid dehydrogenase complex component E2, BCOADC-E2, Branched-chain alpha-keto acid dehydrogenase complex component E2, BCKAD-E2, BCKADE2, BCKDH-E2, Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, Dihydrolipoamide branched chain transacylase, Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase, DBT, BCATE2, BCKDHE2
Reference ARO-P15980
Note For research use only.
Molecular Constructor
Gly62–Lys482 Strep
Product name ARO-P15980-1MG
Uniprot ID P11182
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATELNRLQKLGSVSQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK
Molecular weight 47.68 kDa
Protein delivered with Tag? C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Insect cells
Fragment Type Gly62-Lys482
Aliases /Synonyms Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial, 2.3.1.168, 52 kDa mitochondrial autoantigen of primary biliary cirrhosis, Branched chain 2-oxo-acid dehydrogenase complex component E2, BCOADC-E2, Branched-chain alpha-keto acid dehydrogenase complex component E2, BCKAD-E2, BCKADE2, BCKDH-E2, Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, Dihydrolipoamide branched chain transacylase, Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase, DBT, BCATE2, BCKDHE2
Reference ARO-P15980
Note For research use only.
Molecular Constructor
Gly62–Lys482 Strep
Product name ARO-P15980-50
Uniprot ID P11182
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATELNRLQKLGSVSQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK
Molecular weight 47.68 kDa
Protein delivered with Tag? C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Insect cells
Fragment Type Gly62-Lys482
Aliases /Synonyms Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial, 2.3.1.168, 52 kDa mitochondrial autoantigen of primary biliary cirrhosis, Branched chain 2-oxo-acid dehydrogenase complex component E2, BCOADC-E2, Branched-chain alpha-keto acid dehydrogenase complex component E2, BCKAD-E2, BCKADE2, BCKDH-E2, Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, Dihydrolipoamide branched chain transacylase, Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase, DBT, BCATE2, BCKDHE2
Reference ARO-P15980
Note For research use only.
Molecular Constructor
Gly62–Lys482 Strep

There are no reviews yet.

Be the first to review “Recombinant Human DBT/BCOADC-E2 Protein, C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products